Clone RE63660 Report

Search the DGRC for RE63660

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:636
Well:60
Vector:pFlc-1
Associated Gene/Transcripthdly-RA
Protein status:RE63660.pep: gold
Preliminary Size:1393
Sequenced Size:1397

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5630 2002-01-01 Sim4 clustering to Release 2
CG5630 2003-01-01 Sim4 clustering to Release 3
CG5630 2003-01-22 Blastp of sequenced clone
CG5630 2008-04-29 Release 5.5 accounting
CG5630 2008-08-15 Release 5.9 accounting
CG5630 2008-12-18 5.12 accounting

Clone Sequence Records

RE63660.complete Sequence

1397 bp (1397 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075512

> RE63660.complete
AGTGCAAAGTCGAAAATCTGGCGGTAAACACTGCTGTATCGCGATCCGCG
AGAAAAACATAAAAAACAAAAGCAAAACAAAAAAACGAAAAAAGAAAAAA
CAAACAAAAACCCGCCAGCCAACCGAAGGAGATGAATCGAACTTCGCTGT
CCAGTGGCAGCACCAGCCGCAGACTTCCGGCTCTCTTGTTTGTCCTGCTG
CTCTGCCTGGTGGCCAGGACCAACGGTCGTCCTTCGCAAGAGGACGAGAG
CGACTTGGCCATCATTCCGCCGGATGCCGACAATGTGGAGATCCATAAGG
TTAAAATAGTGAACGGTGTCATGCAAGAAGATCATCCGGTTATCATGTAC
AAGGAGGACTTCGTCAGCGAGGATTATGATCCAACAAAAAGCGAAACAAA
TCCTAGTCACCACAAGAAGCATAAGCGGACGCGGCTCCATCATGCAAAGC
AAGTAACTGGAACAGAAAAGAAGGAGGACCAGATCCTTTTCGATATTCTG
CCCGACAAGCCGATCGTCCTGGAAGAGGACCTCAAGGCTCTCCCACACAG
CAAAGTTGGGGCTGCCCAACTGGCGGAACCCATCAAGGAAGAGTGGCTGG
CTAAGCATCCCAAGAAGTACCACAGTCGCCAGCGACGACAGGCTCCTGTA
AGCTTTGAGAAAGTCCTGCAATACTACTATGGCACTCCGGAAATAAAATT
TGTGTCTCCCTTAACTTATACGCATTTTCGCATTTCAGTGAAGGGTAAGA
AACCCCATCTGGTGGGGCCTCCGAATCGTAGGAATCAGGGCCAAGAGAAT
ATCCCAACGCCAGACTCGGTCGATTCTAGAGGAGAATTCGATTTAATACA
CAATTCAAATCAAGCGGATGCGGATTTCTCGATCTACAACCGTTCGTCTA
CGACTACTGCCAGGCCAATCTTTCAAATCAATGATAGTGACTTTGTGACC
TCGGCACCATCGTGGCGTCCGTCGAACAGCATACGCCGGCCGCCCCCCAC
CCGCTCCCCCGTTGTGGGACTGCCCACCATGCGGCCCAACGCAAGGCCTG
TCCCACAAACAGGGGGGGTCGATAGTGAGCCCAAGGTCAGCAGGTGTGTG
TGGGCGATCGTCAACTGCTGCACGGGCGAGAGCAAGAAGGTGCGGTACAA
CTGCTTCGAGGAGTTCGGATGCCATGGAGCCTTCTGGGACATCAATCCGT
GTGCCGATGAGGGCGTGAAGCAAGGTGCGCTCACCAAGGTCCTGGACGCC
TTCCAAAACCAATGAGCATTGAATTGATCCACTGACTTGCTCAGATTGTC
TCAAACGCAAGCTTAATTTATTTTAAACATAGATTAAGTTATAGCATTTG
TAAATATACACCACTAGCATTTGCATAACATAAAAAAAAAAAAAAAA

RE63660.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG5630.d 1873 CG5630.d 39..1417 1..1380 6860 99.9 Plus
CG5630.e 2166 CG5630.e 39..1417 1..1380 6860 99.9 Plus
CG5630-RA 1479 CG5630-RA 39..1417 1..1380 6860 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16751065..16751500 945..1380 2180 100 Plus
chr3R 27901430 chr3R 16750222..16750568 378..724 1735 100 Plus
chr3R 27901430 chr3R 16750635..16750855 725..945 1105 100 Plus
chr3R 27901430 chr3R 16749800..16749980 110..290 905 100 Plus
chr3R 27901430 chr3R 16738179..16738286 1..109 495 99.1 Plus
chr3R 27901430 chr3R 16750041..16750130 289..378 450 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20927187..20927622 945..1380 2180 100 Plus
3R 32079331 3R 20926344..20926690 378..724 1735 100 Plus
3R 32079331 3R 20926757..20926977 725..945 1105 100 Plus
3R 32079331 3R 20925922..20926102 110..290 905 100 Plus
3R 32079331 3R 20914301..20914408 1..109 495 99.1 Plus
3R 32079331 3R 20926163..20926252 289..378 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20668018..20668453 945..1380 2180 100 Plus
3R 31820162 3R 20667175..20667521 378..724 1735 100 Plus
3R 31820162 3R 20667588..20667808 725..945 1105 100 Plus
3R 31820162 3R 20666753..20666933 110..290 905 100 Plus
3R 31820162 3R 20655132..20655239 1..109 505 99 Plus
3R 31820162 3R 20666994..20667083 289..378 450 100 Plus
Blast to na_te.dros performed 2019-03-15 16:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Doc 4725 Doc DMW1DOC 4725bp Derived from X17551 (g8821) (Rel. 29, Last updated, Version 2). 1148..1217 1272..1340 113 64.3 Plus

RE63660.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:35:57 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16738179..16738228 1..50 100 == Plus
chr3R 16749385..16749396 68..79 100 == Plus
chr3R 16749800..16749980 110..290 100 -> Plus
chr3R 16750043..16750130 291..378 100 -> Plus
chr3R 16750223..16750568 379..724 100 -> Plus
chr3R 16750635..16750855 725..945 100 -> Plus
chr3R 16751066..16751500 946..1381 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:46:57 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
CG5630-RA 1..1134 132..1265 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:20 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
CG5630-RA 1..1134 132..1265 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:05:47 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
CG5630-RA 1..1134 132..1265 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:45:23 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
CG5630-RA 1..1134 132..1265 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:43:21 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
hdly-RA 1..1134 132..1265 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:46:57 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
CG5630-RA 1..1379 1..1381 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:20 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
CG5630-RA 1..1379 1..1381 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:05:47 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
CG5630-RA 6..1384 1..1381 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:45:23 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
CG5630-RA 1..1379 1..1381 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:43:21 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
hdly-RA 6..1384 1..1381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:57 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20925922..20926102 110..290 100 -> Plus
3R 20926165..20926252 291..378 100 -> Plus
3R 20914301..20914408 1..109 99 -> Plus
3R 20926345..20926690 379..724 100 -> Plus
3R 20926757..20926977 725..945 100 -> Plus
3R 20927188..20927622 946..1381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:57 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20925922..20926102 110..290 100 -> Plus
3R 20926165..20926252 291..378 100 -> Plus
3R 20914301..20914408 1..109 99 -> Plus
3R 20926345..20926690 379..724 100 -> Plus
3R 20926757..20926977 725..945 100 -> Plus
3R 20927188..20927622 946..1381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:57 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20925922..20926102 110..290 100 -> Plus
3R 20926165..20926252 291..378 100 -> Plus
3R 20914301..20914408 1..109 99 -> Plus
3R 20926345..20926690 379..724 100 -> Plus
3R 20926757..20926977 725..945 100 -> Plus
3R 20927188..20927622 946..1381 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:05:47 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16740023..16740130 1..109 99 -> Plus
arm_3R 16751887..16751974 291..378 100 -> Plus
arm_3R 16751644..16751824 110..290 100 -> Plus
arm_3R 16752067..16752412 379..724 100 -> Plus
arm_3R 16752479..16752699 725..945 100 -> Plus
arm_3R 16752910..16753344 946..1381 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:16:24 Download gff for RE63660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20667176..20667521 379..724 100 -> Plus
3R 20667588..20667808 725..945 100 -> Plus
3R 20668019..20668453 946..1381 99   Plus
3R 20655132..20655239 1..109 99 -> Plus
3R 20666753..20666933 110..290 100 -> Plus
3R 20666996..20667083 291..378 100 -> Plus

RE63660.hyp Sequence

Translation from 0 to 1264

> RE63660.hyp
VQSRKSGGKHCCIAIREKNIKNKSKTKNEKRKNKQKPASQPKEMNRTSLS
SGSTSRRLPALLFVLLLCLVARTNGRPSQEDESDLAIIPPDADNVEIHKV
KIVNGVMQEDHPVIMYKEDFVSEDYDPTKSETNPSHHKKHKRTRLHHAKQ
VTGTEKKEDQILFDILPDKPIVLEEDLKALPHSKVGAAQLAEPIKEEWLA
KHPKKYHSRQRRQAPVSFEKVLQYYYGTPEIKFVSPLTYTHFRISVKGKK
PHLVGPPNRRNQGQENIPTPDSVDSRGEFDLIHNSNQADADFSIYNRSST
TTARPIFQINDSDFVTSAPSWRPSNSIRRPPPTRSPVVGLPTMRPNARPV
PQTGGVDSEPKVSRCVWAIVNCCTGESKKVRYNCFEEFGCHGAFWDINPC
ADEGVKQGALTKVLDAFQNQ*

RE63660.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
hdly-PC 377 CG5630-PC 1..377 44..420 2014 100 Plus
hdly-PA 377 CG5630-PA 1..377 44..420 2014 100 Plus
hdly-PB 445 CG5630-PB 1..371 44..414 1954 98.4 Plus

RE63660.pep Sequence

Translation from 131 to 1264

> RE63660.pep
MNRTSLSSGSTSRRLPALLFVLLLCLVARTNGRPSQEDESDLAIIPPDAD
NVEIHKVKIVNGVMQEDHPVIMYKEDFVSEDYDPTKSETNPSHHKKHKRT
RLHHAKQVTGTEKKEDQILFDILPDKPIVLEEDLKALPHSKVGAAQLAEP
IKEEWLAKHPKKYHSRQRRQAPVSFEKVLQYYYGTPEIKFVSPLTYTHFR
ISVKGKKPHLVGPPNRRNQGQENIPTPDSVDSRGEFDLIHNSNQADADFS
IYNRSSTTTARPIFQINDSDFVTSAPSWRPSNSIRRPPPTRSPVVGLPTM
RPNARPVPQTGGVDSEPKVSRCVWAIVNCCTGESKKVRYNCFEEFGCHGA
FWDINPCADEGVKQGALTKVLDAFQNQ*

RE63660.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17997-PA 407 GF17997-PA 1..356 1..367 755 47.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24243-PA 435 GG24243-PA 35..431 1..375 1538 82 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18388-PA 513 GH18388-PA 23..435 26..374 601 36.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
hdly-PC 377 CG5630-PC 1..377 1..377 2014 100 Plus
hdly-PA 377 CG5630-PA 1..377 1..377 2014 100 Plus
hdly-PB 445 CG5630-PB 1..371 1..371 1954 98.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10784-PA 361 GI10784-PA 25..360 27..370 606 40.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24290-PA 484 GL24290-PA 1..395 1..362 845 48.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19017-PA 484 GA19017-PA 1..395 1..362 848 49.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15054-PA 451 GM15054-PA 1..377 1..371 1738 90.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19387-PA 454 GD19387-PA 1..380 1..371 1741 90.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14383-PA 401 GJ14383-PA 1..386 1..359 688 42.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22477-PA 411 GK22477-PA 25..320 31..363 533 38.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25698-PA 453 GE25698-PA 1..376 1..368 1426 78.6 Plus