Clone RE63851 Report

Search the DGRC for RE63851

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:638
Well:51
Vector:pFlc-1
Associated Gene/TranscriptMED20-RA
Protein status:RE63851.pep: gold
Preliminary Size:835
Sequenced Size:1049

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18780 2001-12-14 Blastp of sequenced clone
CG18267 2002-01-01 Sim4 clustering to Release 2
CG18780 2003-01-01 Sim4 clustering to Release 3
MED20 2008-04-29 Release 5.5 accounting
MED20 2008-08-15 Release 5.9 accounting
MED20 2008-12-18 5.12 accounting

Clone Sequence Records

RE63851.complete Sequence

1049 bp (1049 high quality bases) assembled on 2001-12-14

GenBank Submission: BT003473

> RE63851.complete
ACTGGTCACACTGGACGCTTTTAGCTTGCAAGACTTGTAAACAAAATTAA
TAAAACTAAAAAGCTGACATTATTGCATAAACTATGGGAGTAACTATCCT
TCAACCGTATCCCTTACCCGAAGGCAAATCGGGTGCCCACATAATCGATC
AGCTGAGCAAGCGTCTGCTCGCCCTGGGCGCCACACATGCCGGTCAATTT
CTGGTGGACTGCGAAACGTTCATCTCGACGCCACAGCCGCACAATGGAGC
ACCTGGACGCGCAGTCCACGTCCTGCACAACTCCGAGTATCCCGCCTCCA
CGTTCTCGATCATCGACAATGGCACCGGCAAACAAGTGGCCATTGTCGCC
GACAATATCTTCGATCTGCTCATGCTCAAGATGACCAACACCTTCACCTC
CAAAAAGCAGACCAAAATCGAGTCCCGTGGCGCTCGTTTCGAGTATGGTG
ACTTTGTTATCAAACTCGGTTCCGTCACCATGATGGAGCACTTCAAGGGC
ATCCTCATCGAAATCGAGTACAAGTCATGCGTGATTCTGGCCTACTGCTG
GGAAATGATACGCGAAATGCTGCAGGGATTCCTCGGCATTGCTGTGAATA
AGGACTTTCCCTCCTATTTCGCTCCACAGACAATAATGACGGCAATGGGG
CAACAGCAGCTGCATGCCAAGCACAACGACATCTTTGAGCCAATGGACAC
CGTGAAACAATACCTGGAGCAGTTCACCAACTATAGGAAGCATGTGACTC
TTATGGGCGGTATGGGCAGTGGACCGGGTAGCCAACAGGTTGGTCCGAAC
GTGCATATGTCGCCGGCGGTGGCGGGACTACATCGATCCTGATCCGCCGA
CGTCAAGCTGGAGCCACCGGATGAGCCTGCAGCCGATTAAGATGTTTAGA
AGATAATTTAAACAAAAAAAATATACATATGTCACTAATATTTAATAATT
AAATAATCATTATTTTAAAGCTAGCATCACTAGTTTGCTTTACATATTTT
AGACGAATAAACAAAACATTTATTAGCTTGTCCAAAAAAAAAAAAAAAA

RE63851.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
MED20-RA 1036 MED20-RA 1..1036 1..1036 5180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8070800..8071832 1033..1 5165 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8071809..8072844 1036..1 5180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8071809..8072844 1036..1 5180 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:35:13 has no hits.

RE63851.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:35:59 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8070800..8071832 1..1033 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:30:08 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RA 1..759 84..842 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:02 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RA 1..759 84..842 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:05:50 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RB 1..807 84..890 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:17 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RA 1..759 84..842 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:43:25 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RB 1..807 84..890 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:41:09 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RA 1..1033 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:02 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RA 1..1033 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:05:50 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RA 5..1037 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:18 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RA 1..1033 1..1033 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:43:25 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
MED20-RA 5..1037 1..1033 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:59 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8071812..8072844 1..1033 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:59 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8071812..8072844 1..1033 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:35:59 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8071812..8072844 1..1033 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:05:50 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8071812..8072844 1..1033 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:31 Download gff for RE63851.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8071812..8072844 1..1033 100   Minus

RE63851.hyp Sequence

Translation from 83 to 841

> RE63851.hyp
MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETFISTP
QPHNGAPGRAVHVLHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKM
TNTFTSKKQTKIESRGARFEYGDFVIKLGSVTMMEHFKGILIEIEYKSCV
ILAYCWEMIREMLQGFLGIAVNKDFPSYFAPQTIMTAMGQQQLHAKHNDI
FEPMDTVKQYLEQFTNYRKHVTLMGGMGSGPGSQQVGPNVHMSPAVAGLH
RS*

RE63851.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
MED20-PA 252 CG18780-PA 1..252 1..252 1322 100 Plus
MED20-PB 268 CG18780-PB 1..252 1..252 1322 100 Plus

RE63851.pep Sequence

Translation from 83 to 841

> RE63851.pep
MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETFISTP
QPHNGAPGRAVHVLHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKM
TNTFTSKKQTKIESRGARFEYGDFVIKLGSVTMMEHFKGILIEIEYKSCV
ILAYCWEMIREMLQGFLGIAVNKDFPSYFAPQTIMTAMGQQQLHAKHNDI
FEPMDTVKQYLEQFTNYRKHVTLMGGMGSGPGSQQVGPNVHMSPAVAGLH
RS*

RE63851.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22602-PA 246 GF22602-PA 1..245 1..251 1177 87.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23479-PA 252 GG23479-PA 1..251 1..251 1317 97.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12797-PA 250 GH12797-PA 1..250 1..252 1060 80.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
MED20-PB 268 CG18780-PB 1..252 1..252 1322 100 Plus
MED20-PA 252 CG18780-PA 1..252 1..252 1322 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15952-PA 246 GI15952-PA 1..231 1..233 1062 83.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19867-PA 256 GL19867-PA 1..242 1..245 1137 85.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28197-PA 256 GA28197-PA 1..242 1..245 1140 85.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13189-PA 252 GM13189-PA 1..251 1..251 1333 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22443-PA 252 GD22443-PA 1..251 1..251 1342 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18844-PA 246 GJ18844-PA 1..246 1..252 1076 80.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16399-PA 253 GK16399-PA 1..241 1..245 1077 83.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11200-PA 252 GE11200-PA 1..251 1..251 1242 95.6 Plus