Clone RE63889 Report

Search the DGRC for RE63889

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:638
Well:89
Vector:pFlc-1
Associated Gene/TranscriptCG30424-RB
Protein status:RE63889.pep: gold
Sequenced Size:913

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30424 2003-01-01 Sim4 clustering to Release 3
CG30424 2008-04-29 Release 5.5 accounting
CG30424 2008-08-15 Release 5.9 accounting
CG30424 2008-12-18 5.12 accounting

Clone Sequence Records

RE63889.complete Sequence

913 bp (913 high quality bases) assembled on 2004-11-04

GenBank Submission: BT021248

> RE63889.complete
ATTGAGATTATTCACTCATCAAATAATATTGTAGAAAAAATGAAGGAGTC
TAGAAATCTTGAAAACTTTGTGGAAAAAAAGCTCTATGAATGCAAAAAGA
AGTATGTTGACATTCCAAAGGACGAGGGACAACGATATGGAACCAGAGTC
CTACTGGCTGAATCCGCTCTCATTCATTTTAGCCGATATGTTCGACGACT
TGGCGGAGAACTTAAGGCGGGGAGTTATTACCTTTTTTTGGGACCCCGAG
CTGAACATGATCGACGCATTGACCCGGGATCAAGTTTGGGAAATGTACCT
GTGCGTGCAAAGGATTCCAAGAGACCTGAGGGGCGCAGAGATCAGCCGGA
ATAAATGGAGTTTTTTCGTACTTCGGGAATTCAGTCACAAAAAGGAAAGA
AATGTAAATCTAAAGTGCAGCTCTAGGCGAAAACGAAATGTTATTAAGGG
ACTGAAGACCACTTCAATTTGCAAGCTAAGAAATGCTCGAACTAACGGTA
CCTGGACTGCTGGACTTTGGACTCGACCCGGCCATGCGTACAGAGGCCCA
TCGGAAACGGTGTCGACTTGGGACACAGTAAAGGACGCAGCGTGGTCAGA
AGGGATTGTGGAGTAAGTGGATAGTGTCCTGCGACACGAGCGGTCCTAAC
AGACGTGCGCTTCCGGGTGGTTGCAAAGGTGGTTCTGGGAAGAGCATTGA
TTCGCAATAATGGAAGTTCTCTAATCTCAGTGCAATTTACATATGTACTC
TCCAGCAATTGTTGAATGCACTTTAGTAGTAATAAGAGGAAAATTAAATG
GCACGCTCTATTTTTTGCCCAAGTTATGTTACAACAATCTATATTGATAA
TTTGGTGCAAAACTAAAAAAAAATAAAACAATGTTGAATATTTTGCCAAA
AAAAAAAAAAAAA

RE63889.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG30424-RB 912 CG30424-RB 13..910 1..898 4475 99.8 Plus
CG30424-RC 1033 CG30424-RC 266..1025 139..898 3800 100 Plus
CG30424.a 965 CG30424.a 204..963 139..898 3800 100 Plus
CG30424-RC 1033 CG30424-RC 32..171 1..140 685 99.2 Plus
CG30424.a 965 CG30424.a 30..168 1..139 680 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20851242..20851755 897..384 2555 99.8 Minus
chr2R 21145070 chr2R 20851811..20852008 385..188 990 100 Minus
chr2R 21145070 chr2R 20853113..20853252 140..1 670 98.6 Minus
chr2R 21145070 chr2R 20852073..20852121 187..139 245 100 Minus
chr3LHet 2555433 chr3LHet 1230047..1230116 624..693 200 85.7 Plus
chr3LHet 2555433 chr3LHet 739904..739965 699..638 190 87.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24965274..24965788 898..384 2575 100 Minus
2R 25286936 2R 24965844..24966041 385..188 990 100 Minus
2R 25286936 2R 24967146..24967285 140..1 685 99.3 Minus
2R 25286936 2R 24966106..24966154 187..139 245 100 Minus
3L 28110227 3L 25847391..25847460 624..693 200 85.7 Plus
3L 28110227 3L 25254426..25254487 699..638 190 87.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24966473..24966987 898..384 2575 100 Minus
2R 25260384 2R 24967043..24967240 385..188 990 100 Minus
2R 25260384 2R 24968345..24968484 140..1 685 99.2 Minus
2R 25260384 2R 24967305..24967353 187..139 245 100 Minus
3L 28103327 3L 25840491..25840560 624..693 200 85.7 Plus
3L 28103327 3L 25247526..25247587 699..638 190 87 Minus
Blast to na_te.dros performed on 2019-03-16 12:43:55 has no hits.

RE63889.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:44:43 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20851242..20851755 384..897 99 <- Minus
chr2R 20851813..20852008 188..383 100 <- Minus
chr2R 20852073..20852120 140..187 100 <- Minus
chr2R 20853114..20853252 1..139 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:30:11 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 1..531 86..616 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:28:30 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 1..531 86..616 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:51:12 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 1..531 86..616 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:12:28 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 1..531 86..616 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:53:19 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 1..531 86..616 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:32:01 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 1..897 1..897 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:28:30 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 1..897 1..897 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:51:12 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 14..910 1..897 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:12:28 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 1..897 1..897 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:53:19 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
CG30424-RB 14..910 1..897 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:43 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24965275..24965788 384..897 100 <- Minus
2R 24965846..24966041 188..383 100 <- Minus
2R 24966106..24966153 140..187 100 <- Minus
2R 24967147..24967285 1..139 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:43 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24965275..24965788 384..897 100 <- Minus
2R 24965846..24966041 188..383 100 <- Minus
2R 24966106..24966153 140..187 100 <- Minus
2R 24967147..24967285 1..139 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:43 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24965275..24965788 384..897 100 <- Minus
2R 24965846..24966041 188..383 100 <- Minus
2R 24966106..24966153 140..187 100 <- Minus
2R 24967147..24967285 1..139 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:51:12 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20852798..20853311 384..897 100 <- Minus
arm_2R 20853369..20853564 188..383 100 <- Minus
arm_2R 20853629..20853676 140..187 100 <- Minus
arm_2R 20854670..20854808 1..139 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:49:06 Download gff for RE63889.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24968364..24968502 1..139 99   Minus
2R 24966492..24967005 384..897 100 <- Minus
2R 24967063..24967258 188..383 100 <- Minus
2R 24967323..24967370 140..187 100 <- Minus

RE63889.pep Sequence

Translation from 85 to 615

> RE63889.pep
MNAKRSMLTFQRTRDNDMEPESYWLNPLSFILADMFDDLAENLRRGVITF
FWDPELNMIDALTRDQVWEMYLCVQRIPRDLRGAEISRNKWSFFVLREFS
HKKERNVNLKCSSRRKRNVIKGLKTTSICKLRNARTNGTWTAGLWTRPGH
AYRGPSETVSTWDTVKDAAWSEGIVE*

RE63889.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11519-PA 419 GF11519-PA 306..362 20..75 168 52.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19870-PA 354 GG19870-PA 267..349 19..100 244 60.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG30424-PB 176 CG30424-PB 1..176 1..176 948 100 Plus
CG30424-PE 188 CG30424-PE 1..188 1..176 925 93.6 Plus
CG30424-PD 389 CG30424-PD 232..389 19..176 856 100 Plus
CG30424-PC 142 CG30424-PC 1..142 35..176 768 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10891-PA 382 GL10891-PA 297..367 19..89 197 49.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15837-PA 382 GA15837-PA 297..367 19..89 197 49.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24904-PA 383 GD24904-PA 265..357 2..100 350 72.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11395-PA 413 GE11395-PA 300..403 19..123 287 57.5 Plus

RE63889.hyp Sequence

Translation from 85 to 615

> RE63889.hyp
MNAKRSMLTFQRTRDNDMEPESYWLNPLSFILADMFDDLAENLRRGVITF
FWDPELNMIDALTRDQVWEMYLCVQRIPRDLRGAEISRNKWSFFVLREFS
HKKERNVNLKCSSRRKRNVIKGLKTTSICKLRNARTNGTWTAGLWTRPGH
AYRGPSETVSTWDTVKDAAWSEGIVE*

RE63889.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG30424-PB 176 CG30424-PB 1..176 1..176 948 100 Plus
CG30424-PE 188 CG30424-PE 1..188 1..176 925 93.6 Plus
CG30424-PD 389 CG30424-PD 232..389 19..176 856 100 Plus
CG30424-PC 142 CG30424-PC 1..142 35..176 768 100 Plus