Clone RE64145 Report

Search the DGRC for RE64145

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:641
Well:45
Vector:pFlc-1
Associated Gene/Transcriptrobl-RA
Protein status:RE64145.pep: gold
Preliminary Size:504
Sequenced Size:541

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10751 2001-12-14 Blastp of sequenced clone
CG10751 2002-01-01 Sim4 clustering to Release 2
CG10751 2003-01-01 Sim4 clustering to Release 3
robl 2008-04-29 Release 5.5 accounting
robl 2008-08-15 Release 5.9 accounting
robl 2008-12-18 5.12 accounting

Clone Sequence Records

RE64145.complete Sequence

541 bp (541 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071587

> RE64145.complete
AGTGCATCTCTAATATTGAACAAACAAAGTTTACTATTTCATTGAACTGC
AGGTAGCGGTAGTGTCTGCCGTGTTTCCAACAAAATTATAAGAAAAAATG
TCGCAGGAGGTTGAGGAAACACTCAAGAGAATCCAGAGCCACAAAGGTGT
TGTGGGTACAATTGTGGTCAACAATGAAGGTATTCCGGTCAAATCCACGC
TGGACAACACTACCACCGTTCAGTACGCTGGCCTAATGAGTCAGCTGGCG
GACAAGGCACGAAGTGTGGTGAGGGACTTGGATCCTTCCAACGACATGAC
ATTCCTGCGGGTGCGATCCAAGAAGCACGAGATCATGGTGGCACCCGACA
AGGACTTCATCCTGATTGTCATCCAAAACCCAACCGACTAAATGGCATGG
TGCATCGCGACTATTGCTGAATTATCTGCACATTTATATCTGTATTCTAA
TCATCAGCGTATAAATGGAAAGTTAAATTATAATGTAATGAAATTGTACT
CCATACAATAAATATATTTATGCATAAAAAAAAAAAAAAAA

RE64145.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
robl-RA 591 robl-RA 25..553 1..529 2645 100 Plus
robl.b 744 robl.b 25..553 1..529 2645 100 Plus
robl.a 532 robl.a 7..529 1..529 2530 98.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13343851..13344198 178..525 1740 100 Plus
chr2R 21145070 chr2R 13343543..13343642 1..100 500 100 Plus
chr2R 21145070 chr2R 13343705..13343786 100..181 410 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17456782..17457133 178..529 1760 100 Plus
2R 25286936 2R 17456474..17456573 1..100 500 100 Plus
2R 25286936 2R 17456636..17456717 100..181 410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17457981..17458332 178..529 1760 100 Plus
2R 25260384 2R 17457673..17457772 1..100 500 100 Plus
2R 25260384 2R 17457835..17457916 100..181 410 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:57:02 has no hits.

RE64145.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:57:58 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13343706..13343784 101..179 100 -> Plus
chr2R 13343543..13343642 1..100 100 -> Plus
chr2R 13343853..13344198 180..525 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:30:24 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 1..294 98..391 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:14 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 1..294 98..391 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:32 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 1..294 98..391 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:51 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 1..294 98..391 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:26:14 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 1..294 98..391 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:00 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:14 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:32 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 3..527 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:52 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:26:14 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
robl-RA 3..527 1..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:58 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17456784..17457129 180..525 100   Plus
2R 17456474..17456573 1..100 100 -> Plus
2R 17456637..17456715 101..179 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:58 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17456784..17457129 180..525 100   Plus
2R 17456474..17456573 1..100 100 -> Plus
2R 17456637..17456715 101..179 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:58 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17456784..17457129 180..525 100   Plus
2R 17456474..17456573 1..100 100 -> Plus
2R 17456637..17456715 101..179 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:32 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13343979..13344078 1..100 100 -> Plus
arm_2R 13344142..13344220 101..179 100 -> Plus
arm_2R 13344289..13344634 180..525 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:00 Download gff for RE64145.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17457983..17458328 180..525 100   Plus
2R 17457673..17457772 1..100 100 -> Plus
2R 17457836..17457914 101..179 100 -> Plus

RE64145.pep Sequence

Translation from 97 to 390

> RE64145.pep
MSQEVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQL
ADKARSVVRDLDPSNDMTFLRVRSKKHEIMVAPDKDFILIVIQNPTD*

RE64145.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13122-PA 97 GF13122-PA 1..97 1..97 504 100 Plus
Dana\GF15283-PA 97 GF15283-PA 1..97 1..97 279 47.4 Plus
Dana\GF21526-PA 97 GF21526-PA 1..97 1..97 242 43.3 Plus
Dana\GF12509-PA 141 GF12509-PA 36..128 5..97 191 34.4 Plus
Dana\GF19684-PA 122 GF19684-PA 6..95 5..94 179 36.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20680-PA 100 GG20680-PA 4..100 1..97 498 99 Plus
Dere\GG24530-PA 97 GG24530-PA 1..97 1..97 306 54.6 Plus
Dere\GG21468-PA 97 GG21468-PA 1..95 1..95 247 45.3 Plus
Dere\GG22008-PA 114 GG22008-PA 15..107 5..97 206 35.5 Plus
Dere\GG22968-PA 131 GG22968-PA 41..120 14..93 179 41.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21399-PA 97 GH21399-PA 1..97 1..97 504 100 Plus
Dgri\GH13788-PA 97 GH13788-PA 1..97 1..97 284 54.6 Plus
Dgri\GH20486-PA 108 GH20486-PA 16..105 5..94 187 38.9 Plus
Dgri\GH21001-PA 114 GH21001-PA 29..106 16..93 184 43.6 Plus
Dgri\GH22877-PA 116 GH22877-PA 15..107 5..97 167 30.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
robl-PA 97 CG10751-PA 1..97 1..97 483 100 Plus
robl22E-PB 97 CG10838-PB 1..97 1..97 285 54.6 Plus
robl22E-PA 97 CG10838-PA 1..97 1..97 285 54.6 Plus
CG10834-PA 97 CG10834-PA 1..95 1..95 230 44.2 Plus
CG10822-PA 114 CG10822-PA 15..107 5..97 199 35.5 Plus
CG16837-PA 130 CG16837-PA 40..119 14..93 175 42.5 Plus
robls54B-PA 112 CG34192-PA 16..108 5..97 158 30.1 Plus
robls54B-PB 112 CG34192-PB 16..108 5..97 158 30.1 Plus
robl37BC-PA 115 CG15171-PA 3..95 2..94 155 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18578-PA 108 GI18578-PA 13..108 2..97 499 100 Plus
Dmoj\GI16945-PA 110 GI16945-PA 1..87 2..88 407 89.7 Plus
Dmoj\GI17191-PA 97 GI17191-PA 1..97 1..97 230 41.2 Plus
Dmoj\GI20640-PA 116 GI20640-PA 32..110 16..94 186 43 Plus
Dmoj\GI21029-PA 100 GI21029-PA 6..97 3..94 176 34.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11426-PA 97 GL11426-PA 1..97 1..97 504 100 Plus
Dper\GL19405-PA 97 GL19405-PA 1..97 1..97 289 54.6 Plus
Dper\GL26110-PA 97 GL26110-PA 1..97 1..97 233 42.3 Plus
Dper\GL27334-PA 112 GL27334-PA 3..93 4..94 187 36.3 Plus
Dper\GL11036-PA 89 GL11036-PA 1..74 24..97 156 32.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10543-PA 97 GA10543-PA 1..97 1..97 504 100 Plus
Dpse\GA10586-PA 97 GA10586-PA 1..97 1..97 289 54.6 Plus
Dpse\GA10585-PA 97 GA10585-PA 1..97 1..97 237 42.3 Plus
Dpse\GA13548-PA 112 GA13548-PA 3..93 4..94 181 35.2 Plus
Dpse\GA24584-PA 89 GA24584-PA 1..74 24..97 156 32.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21776-PA 97 GM21776-PA 1..97 1..97 504 100 Plus
Dsec\GM26651-PA 97 GM26651-PA 1..97 1..97 504 100 Plus
Dsec\GM18239-PA 97 GM18239-PA 1..97 1..97 288 51.5 Plus
Dsec\GM16116-PA 97 GM16116-PA 1..95 1..95 247 45.3 Plus
Dsec\GM21987-PA 114 GM21987-PA 15..107 5..97 207 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11269-PA 97 GD11269-PA 1..97 1..97 504 100 Plus
Dsim\GD22844-PA 97 GD22844-PA 1..97 1..97 288 51.5 Plus
Dsim\GD21619-PA 97 GD21619-PA 1..95 1..95 247 45.3 Plus
Dsim\GD11487-PA 111 GD11487-PA 15..107 5..97 207 35.5 Plus
Dsim\GD11860-PA 130 GD11860-PA 40..119 14..93 179 42.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20372-PA 97 GJ20372-PA 1..97 1..97 504 100 Plus
Dvir\GJ22281-PA 97 GJ22281-PA 1..97 1..97 277 53.6 Plus
Dvir\GJ21607-PA 119 GJ21607-PA 35..112 16..93 195 46.2 Plus
Dvir\GJ21956-PA 106 GJ21956-PA 14..103 5..94 185 37.8 Plus
Dvir\GJ20860-PA 116 GJ20860-PA 15..107 5..97 163 29 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22899-PA 97 GK22899-PA 1..97 1..97 504 100 Plus
Dwil\GK14988-PA 97 GK14988-PA 1..97 1..97 304 56.7 Plus
Dwil\GK18698-PA 97 GK18698-PA 1..97 1..97 253 45.4 Plus
Dwil\GK19376-PA 116 GK19376-PA 1..94 1..94 230 40.4 Plus
Dwil\GK15784-PA 118 GK15784-PA 16..108 5..97 192 37.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11664-PA 97 GE11664-PA 1..97 1..97 504 100 Plus
Dyak\GE15136-PA 97 GE15136-PA 1..97 1..97 302 54.6 Plus
Dyak\GE12939-PA 97 GE12939-PA 1..95 1..95 247 45.3 Plus
Dyak\GE12086-PA 114 GE12086-PA 15..107 5..97 201 34.4 Plus
Dyak\GE14408-PA 133 GE14408-PA 44..122 15..93 171 41.8 Plus

RE64145.hyp Sequence

Translation from 97 to 390

> RE64145.hyp
MSQEVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQL
ADKARSVVRDLDPSNDMTFLRVRSKKHEIMVAPDKDFILIVIQNPTD*

RE64145.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
robl-PA 97 CG10751-PA 1..97 1..97 483 100 Plus
robl22E-PB 97 CG10838-PB 1..97 1..97 285 54.6 Plus
robl22E-PA 97 CG10838-PA 1..97 1..97 285 54.6 Plus
CG10834-PA 97 CG10834-PA 1..95 1..95 230 44.2 Plus
CG10822-PA 114 CG10822-PA 15..107 5..97 199 35.5 Plus