Clone RE64759 Report

Search the DGRC for RE64759

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:647
Well:59
Vector:pFlc-1
Associated Gene/TranscriptCG3355-RB
Protein status:RE64759.pep: gold
Preliminary Size:1032
Sequenced Size:1360

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3355 2002-01-01 Sim4 clustering to Release 2
CG3355 2003-01-01 Sim4 clustering to Release 3
CG3355 2003-07-07 Blastp of sequenced clone
CG3355 2008-04-29 Release 5.5 accounting
CG3355 2008-08-15 Release 5.9 accounting
CG3355 2008-12-18 5.12 accounting

Clone Sequence Records

RE64759.complete Sequence

1360 bp (1360 high quality bases) assembled on 2003-07-07

GenBank Submission: AY118411

> RE64759.complete
GTCTCTTTCCTCAGAAGTCAACTCCGGACAAGATGCGCGTCTACCTGGCC
CTGCCGCTCCTGCTGCTGGGCATCGGCCTCAGTTTGGCCCAGTACCAGTA
TCAAGCGCCCCACCAAACCCTCGCCCAGCAATTCGCCGACGTGGTGGATG
TGGTCGATCCTGCAGAACAATCTATCAAAGCAGTGCGACCACCGAAGAGC
CGCAATCAGTGCACCGCCAAGCAGAACTGCTTCTGCGGCACTCCGAATGT
CAACCGTATCGTGGGCGGCCAGCAGGTGCGCTCCAACAAGTATCCTTGGA
CCGCCCAATTGGTAAAGGGTCGTCATTATCCCCGCCTCTTCTGCGGCGGT
TCCCTAATCAATGATCGCTATGTGCTGACCGCCGCCCATTGTGTGCATGG
GAACAGGGATCAGATCACCATTCGCCTGCTCCAGATCGACAGATCCTCCC
GGGATCCCGGCATTGTGCGCAAGGTCGTCCAGACCACTGTGCATCCTAAC
TACGATCCCAACCGGATTGTCAACGATGTGGCGCTGCTCAAGCTGGAGTC
CCCTGTTCCACTGACTGGAAACATGCGTCCAGTCTGTCTGCCCGAGGCCA
ATCATAACTTTGATGGCAAGACCGTGAGTACAAGTCTTGATTTATGTGCT
AAACTGTATTTCCTTTTATGTAGGCCTGAATAGAAGTTTTCAGGGCGTAC
ATAAAATATTTACGAGCCTATAAGGAAAACATCTAAATCTGAATGTTCTT
AGTCGAGTCAATCAAGACATTCGAAATTTATGACTAAAAATCTGACCATT
ATTTAGACCTAGTATTAGCAGTAATATTATTAGTAGTTAATAGTTATAGA
TATTTAAAGCATAGTCACTGACTTCTAAATCCCTTCCAGGCTGTGGTTGC
TGGCTGGGGTTTGATCAAGGAGGGCGGCGTCACCTCCAACTATCTGCAGG
AGGTCAATGTGCCCGTCATCACCAACGCGCAGTGTCGCCAGACGCGCTAC
AAGGACAAGATTGCCGAGGTGATGCTCTGCGCCGGATTGGTGCAGCAGGG
TGGCAAGGACGCCTGCCAGGGCGACAGTGGTGGCCCACTGATCGTCAACG
AGGGTCGCTACAAGCTGGCCGGCGTGGTGTCCTTCGGCTACGGATGTGCA
CAGAAGGATGCGCCGGGTGTCTACGCCAGGGTGAGCAAGTTCCTGGACTG
GATCCGTAAGAACACCGCCGACGGCTGCTACTGCCAGAGTTAGATCATTT
GGCTAAAAAAAAACTCATTTCCTTGCCTCATTCCTAAGTTATTCTAAATT
ATTGAAAAAAGAAGTTCACAGCAAATAAATCCATCAAATGCTTTAAAAAA
AAAAAAAAAA

RE64759.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-RB 1399 CG3355-RB 56..1399 1..1344 6690 99.8 Plus
CG3355-RA 1269 CG3355-RA 70..693 1..624 3105 99.8 Plus
CG3355-RA 1269 CG3355-RA 693..1149 890..1346 2270 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4650890..4652001 232..1344 5335 98.8 Plus
chr2L 23010047 chr2L 4650583..4650813 1..231 1140 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:10:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4651765..4652879 232..1346 5560 99.9 Plus
2L 23513712 2L 4651458..4651688 1..231 1140 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4651765..4652879 232..1346 5560 99.9 Plus
2L 23513712 2L 4651458..4651688 1..231 1140 99.5 Plus
Blast to na_te.dros performed on 2019-03-16 02:58:23 has no hits.

RE64759.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:59:30 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4650583..4650813 1..231 99 -> Plus
chr2L 4650890..4652001 232..1344 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:30:51 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 1..651 33..683 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:31:31 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 1..651 33..683 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:25:09 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 1..651 33..683 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:05:13 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 1..651 33..683 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:26:59 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 1..651 33..683 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:32:48 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 56..1399 1..1344 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:31:31 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 56..1399 1..1344 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:09 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 56..1399 1..1344 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:05:14 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 56..1399 1..1344 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:26:59 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RB 56..1399 1..1344 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:30 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4651458..4651688 1..231 99 -> Plus
2L 4651765..4652877 232..1344 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:30 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4651458..4651688 1..231 99 -> Plus
2L 4651765..4652877 232..1344 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:30 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4651458..4651688 1..231 99 -> Plus
2L 4651765..4652877 232..1344 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:09 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4651458..4651688 1..231 99 -> Plus
arm_2L 4651765..4652877 232..1344 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:43:21 Download gff for RE64759.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4651458..4651688 1..231 99 -> Plus
2L 4651765..4652877 232..1344 99   Plus

RE64759.pep Sequence

Translation from 2 to 682

> RE64759.pep
LFPQKSTPDKMRVYLALPLLLLGIGLSLAQYQYQAPHQTLAQQFADVVDV
VDPAEQSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWT
AQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSSR
DPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEAN
HNFDGKTVSTSLDLCAKLYFLLCRPE*

RE64759.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21354-PA 315 GF21354-PA 1..198 11..207 938 89.4 Plus
Dana\GF25196-PA 379 GF25196-PA 89..259 38..204 415 48.9 Plus
Dana\GF11616-PA 379 GF11616-PA 122..254 75..207 298 42.6 Plus
Dana\GF11617-PA 354 GF11617-PA 53..199 53..208 285 41.5 Plus
Dana\GF13273-PA 350 GF13273-PA 79..218 63..204 270 43.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25012-PA 314 GG25012-PA 1..197 11..207 934 94.4 Plus
Dere\GG13724-PA 376 GG13724-PA 124..256 68..204 402 56.8 Plus
Dere\GG20743-PA 372 GG20743-PA 115..246 75..206 287 42.2 Plus
Dere\GG22144-PA 343 GG22144-PA 81..211 76..204 275 45.5 Plus
Dere\GG20744-PA 364 GG20744-PA 6..204 20..208 270 32.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13131-PA 318 GH13131-PA 1..205 11..211 827 74.6 Plus
Dgri\GH14456-PA 359 GH14456-PA 107..239 68..204 385 54.7 Plus
Dgri\GH20776-PA 378 GH20776-PA 113..253 61..207 302 42.7 Plus
Dgri\GH20777-PA 356 GH20777-PA 45..197 47..208 287 40 Plus
Dgri\GH21133-PA 349 GH21133-PA 71..206 69..206 260 43 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-PB 216 CG3355-PB 1..216 11..226 1146 100 Plus
CG3355-PA 314 CG3355-PA 1..197 11..207 1046 100 Plus
CG4613-PC 374 CG4613-PC 122..254 68..204 402 56.8 Plus
CG4613-PB 374 CG4613-PB 122..254 68..204 402 56.8 Plus
CG4386-PA 372 CG4386-PA 104..246 64..206 286 40.4 Plus
CG18735-PA 364 CG18735-PA 58..203 53..207 270 39.9 Plus
CG9294-PB 352 CG9294-PB 90..220 76..204 263 44.8 Plus
CG32260-PC 395 CG32260-PC 125..265 63..199 242 34.8 Plus
CG32260-PA 575 CG32260-PA 305..445 63..199 242 34.8 Plus
CG4914-PA 374 CG4914-PA 105..244 64..204 238 38.5 Plus
CG11836-PI 281 CG11836-PI 24..165 66..206 223 36.3 Plus
CG11836-PJ 333 CG11836-PJ 76..217 66..206 223 36.3 Plus
Sp7-PF 391 CG3066-PF 92..266 54..197 215 35.2 Plus
Sp7-PE 391 CG3066-PE 92..266 54..197 215 35.2 Plus
Sp7-PA 391 CG3066-PA 92..266 54..197 215 35.2 Plus
CG8172-PD 371 CG8172-PD 113..256 75..211 212 36.1 Plus
CG8172-PE 545 CG8172-PE 298..430 84..211 211 36.8 Plus
CG8172-PF 561 CG8172-PF 314..446 84..211 211 36.8 Plus
grass-PA 335 CG5896-PA 65..203 74..197 210 35 Plus
grass-PB 377 CG5896-PB 107..245 74..197 210 35 Plus
CG5909-PA 381 CG5909-PA 122..256 78..197 210 36.3 Plus
lint-PB 1674 CG8213-PB 1419..1561 78..211 196 36.1 Plus
lint-PC 1693 CG8213-PC 1438..1580 78..211 196 36.1 Plus
ea-PA 392 CG4920-PA 120..280 78..211 193 35.5 Plus
CG34458-PA 257 CG34458-PA 30..152 84..209 191 33.1 Plus
l(2)k05911-PC 639 CG31728-PC 394..514 80..197 191 36.3 Plus
CG9372-PA 408 CG9372-PA 161..296 73..206 189 28.5 Plus
CG7432-PB 721 CG7432-PB 471..597 82..198 188 35.9 Plus
CG34409-PB 511 CG34409-PB 242..359 78..197 187 33.3 Plus
CG31220-PB 363 CG31220-PB 95..237 78..196 185 36.4 Plus
MP1-PA 390 CG1102-PA 120..275 78..208 185 34.8 Plus
MP1-PC 399 CG1102-PC 129..284 78..208 185 34.8 Plus
MP1-PE 400 CG1102-PE 130..285 78..208 185 34.8 Plus
Sb-PB 787 CG4316-PB 532..665 78..200 185 35.1 Plus
Sb-PA 787 CG4316-PA 532..665 78..200 185 35.1 Plus
Np-PB 1041 CG34350-PB 797..924 85..207 185 34.4 Plus
Np-PA 1041 CG34350-PA 797..924 85..207 185 34.4 Plus
CG1304-PA 260 CG1304-PA 31..149 85..200 184 37.9 Plus
CG18420-PA 299 CG18420-PA 42..150 85..196 184 41.1 Plus
CG43742-PB 474 CG43742-PB 57..142 113..196 183 43.7 Plus
CG10663-PD 748 CG10663-PD 503..615 82..198 182 35.6 Plus
CG10663-PB 748 CG10663-PB 503..615 82..198 182 35.6 Plus
CG30371-PA 399 CG30371-PA 135..267 71..197 180 33.6 Plus
CG31219-PB 345 CG31219-PB 33..232 31..207 179 29.1 Plus
CG9737-PA 424 CG9737-PA 142..279 78..197 177 32.9 Plus
Ser6-PA 259 CG2071-PA 31..146 85..197 174 36.6 Plus
CG43335-PA 281 CG43335-PA 41..154 85..196 173 31.4 Plus
CG4998-PA 891 CG4998-PA 616..769 67..205 173 31.8 Plus
CG5390-PB 406 CG5390-PB 135..272 78..204 171 32.9 Plus
CG5390-PA 406 CG5390-PA 135..272 78..204 171 32.9 Plus
Send1-PA 255 CG17012-PA 29..147 85..210 167 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22815-PA 312 GI22815-PA 1..199 11..211 759 76.4 Plus
Dmoj\GI13599-PA 364 GI13599-PA 99..236 51..197 419 55.4 Plus
Dmoj\GI20861-PA 359 GI20861-PA 6..200 19..208 283 37.4 Plus
Dmoj\GI20860-PA 396 GI20860-PA 131..270 61..206 281 40.3 Plus
Dmoj\GI13812-PA 377 GI13812-PA 109..247 64..204 231 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14423-PA 314 GL14423-PA 1..198 11..208 887 90.5 Plus
Dper\GL20989-PA 369 GL20989-PA 117..249 68..204 400 56.1 Plus
Dper\GL17516-PA 377 GL17516-PA 112..252 61..207 287 40.7 Plus
Dper\GL17517-PA 363 GL17517-PA 3..202 14..208 281 33.3 Plus
Dper\GL26150-PA 373 GL26150-PA 104..236 64..197 238 39.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17401-PA 314 GA17401-PA 1..197 11..207 890 91.5 Plus
Dpse\GA18302-PA 369 GA18302-PA 117..249 68..204 401 56.1 Plus
Dpse\GA18150-PA 375 GA18150-PA 110..250 61..207 288 40.7 Plus
Dpse\GA15058-PA 364 GA15058-PA 55..203 63..208 282 40.1 Plus
Dpse\GA21676-PA 333 GA21676-PA 70..201 75..204 276 44.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18483-PA 314 GM18483-PA 1..197 11..207 1045 99.5 Plus
Dsec\GM24545-PA 394 GM24545-PA 142..274 68..204 397 56.1 Plus
Dsec\GM15686-PA 372 GM15686-PA 115..246 75..206 289 42.2 Plus
Dsec\GM15687-PA 364 GM15687-PA 58..204 53..208 278 40.3 Plus
Dsec\GM15869-PA 313 GM15869-PA 66..181 90..204 241 45.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23293-PA 314 GD23293-PA 1..197 11..207 1049 100 Plus
Dsim\GD12618-PA 394 GD12618-PA 142..274 68..204 396 56.1 Plus
Dsim\GD25165-PA 372 GD25165-PA 115..246 75..206 287 42.2 Plus
Dsim\GD25166-PA 364 GD25166-PA 58..204 53..208 273 39.6 Plus
Dsim\GD11631-PA 354 GD11631-PA 92..222 76..204 271 46.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23363-PA 318 GJ23363-PA 1..201 11..207 780 79.6 Plus
Dvir\GJ13936-PA 357 GJ13936-PA 92..237 51..204 407 53.8 Plus
Dvir\GJ21756-PA 345 GJ21756-PA 85..216 75..206 302 47.4 Plus
Dvir\GJ20595-PA 373 GJ20595-PA 108..247 61..206 289 40.9 Plus
Dvir\GJ20596-PA 354 GJ20596-PA 44..198 47..208 278 39.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23752-PA 324 GK23752-PA 21..208 27..208 846 86.7 Plus
Dwil\GK10288-PA 384 GK10288-PA 107..263 53..204 404 51.5 Plus
Dwil\GK15653-PA 375 GK15653-PA 60..214 49..208 294 39.3 Plus
Dwil\GK15652-PA 366 GK15652-PA 109..241 75..207 294 41.9 Plus
Dwil\GK15931-PA 357 GK15931-PA 95..227 76..206 253 39.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18301-PA 314 GE18301-PA 1..197 11..207 1028 97.5 Plus
Dyak\GE20019-PA 374 GE20019-PA 122..254 68..204 401 56.1 Plus
Dyak\GE13675-PA 378 GE13675-PA 121..252 75..206 289 42.2 Plus
Dyak\GE12225-PA 359 GE12225-PA 96..227 75..204 270 45.9 Plus
Dyak\GE13676-PA 364 GE13676-PA 58..204 53..208 268 39.6 Plus

RE64759.hyp Sequence

Translation from 2 to 682

> RE64759.hyp
HFPQKSTPDKMRVYLALPLLLLGIGLSLAQYQYQAPHQTLAQQFADVVDV
VDPAEQSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWT
AQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSSR
DPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEAN
HNFDGKTVSTSLDLCAKLYFLLCRPE*

RE64759.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-PB 216 CG3355-PB 1..216 11..226 1146 100 Plus
CG3355-PA 314 CG3355-PA 1..197 11..207 1046 100 Plus
CG4613-PC 374 CG4613-PC 122..254 68..204 402 56.8 Plus
CG4613-PB 374 CG4613-PB 122..254 68..204 402 56.8 Plus
CG4386-PA 372 CG4386-PA 104..246 64..206 286 40.4 Plus