Clone RE64884 Report

Gene	Date	Evidence
CG7118	2001-12-14	Blastp of sequenced clone
CG7118	2002-01-01	Sim4 clustering to Release 2
CG7118	2003-01-01	Sim4 clustering to Release 3
Jon66Ci	2008-04-29	Release 5.5 accounting
Jon66Ci	2008-08-15	Release 5.9 accounting
Jon66Ci	2008-12-18	5.12 accounting

Clone Sequence Records

RE64884.complete Sequence

851 bp (851 high quality bases) assembled on 2001-12-14

GenBank Submission: AY075514

> RE64884.complete
ATGTTGTTTCTGCAACATGAAGGTGTTCCTAACTATTCTGGCTTTGGCCG
TGGCCTCCGCCTCGGCGTACGAGAGCGTCGTGCACCCCAAGGATCTGTCC
AAGGTGGCCAAGATCGAGGGTCGCATCACCAACGGCTATCCGGCTGAGGA
GGGCAAGGCTCCCTACACCGTCGGTCTGGGTTTCAGCGGCGGCTGGTGGT
GCGGTGGCTCCATCATCTCCAACGAGTGGGTCCTCACCGCCGAGCACTGC
ATCGGAGGTGATGCAGTGACTGTCTACTTCGGAGCAACCTGGCGCACCAA
CGCCCAGTTCACCCACTGGGTTGGAAGCGGCAACTTCATCACCCACGGAT
CTGCTGACATCGCCCTCATCCGCATTCCCCACGTGGACTTCTGGCACATG
GTGAACAAGGTGGAGCTGCCCAGCTACAACGATCGCTACAACGACTACAA
CGAATGGTGGGCTGTTGCCTGCGGCTGGGGAGGCACCTATGACGGCAGCC
CACTGCCCGACTACCTGCAGTGTGTCGATCTCCAGATCATCCACAACTCC
GAGTGCGCCAGCTACTACGGAACCGGCACCGTCGGCGACAACATCATCTG
CGTGCGCGTGGTCGATGGCAAGGGCACCTGCGGTGGCGACTCCGGCGGTC
CTCTGGTCACCCATGACGGCAGCAAGCTTGTGGGAGTCACCAACTGGGTG
TCGGGAGCCGGTTGCCAGGCTGGCCACCCCGCTGGCTTCCAGCGTGTGAC
CTACCACTTGGACTGGATCCGTGACCACACCGGCATTGCTTACTACTAAG
CAACGATTTTCGATTGAATAAAAATATTTAAAGTACAAAAAAAAAAAAAA
A

RE64884.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:39

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Jon66Ci-RA	838	Jon66Ci-RA	3..838	3..838	4165	99.8	Plus
Jon66Cii-RA	792	Jon66Cii-RA	113..571	117..572	1790	93	Plus
Jon25Biii-RA	817	Jon25Biii-RA	355..559	353..557	710	89.7	Plus
Jon66Cii-RA	792	Jon66Cii-RA	606..792	613..799	500	84.4	Plus
Jon25Biii-RA	817	Jon25Biii-RA	148..256	149..257	380	89.9	Plus
Jon25Biii-RA	817	Jon25Biii-RA	727..791	731..795	235	90.7	Plus
Jon25Biii-RA	817	Jon25Biii-RA	277..343	275..341	230	89.5	Plus
Jon25Biii-RA	817	Jon25Biii-RA	15..62	16..63	165	89.5	Plus

Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:04:12

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
chr3L	24539361	chr3L	8383566..8384397	3..834	4130	99.8	Plus
chr3L	24539361	chr3L	8384855..8385559	824..117	2165	87.6	Minus
chr2L	23010047	chr2L	4949073..4949849	795..16	1535	80.3	Minus
chr3R	27901430	chr3R	26309875..26310059	540..356	505	84.9	Minus
chr3R	27901430	chr3R	26311889..26312073	356..540	505	84.9	Plus
chr3R	27901430	chr3R	25745031..25745215	356..540	460	83.2	Plus
chr3R	27901430	chr3R	25746460..25746644	540..356	460	83.2	Minus
chr2L	23010047	chr2L	4953891..4954154	340..86	395	78.4	Minus
chr3L	24539361	chr3L	6046573..6046787	480..266	385	78.6	Minus
chr2L	23010047	chr2L	4953421..4953857	801..356	385	74	Minus
chr2R	21145070	chr2R	4579423..4579668	356..601	360	76.4	Plus
chr3L	24539361	chr3L	6045385..6045491	356..462	310	86	Plus
chr3R	27901430	chr3R	26310099..26310336	337..109	295	76.9	Minus
chr3R	27901430	chr3R	26311612..26311849	109..337	295	76.9	Plus
chr3R	27901430	chr3R	25744762..25744994	117..340	255	76	Plus
chr3R	27901430	chr3R	25746681..25746913	340..117	255	76	Minus
chr2L	23010047	chr2L	4952022..4952101	191..112	235	86.2	Minus
chr2R	21145070	chr2R	4579152..4579297	109..251	215	78.1	Plus
chr3R	27901430	chr3R	26309638..26309799	786..625	210	75.3	Minus
chr3R	27901430	chr3R	26312149..26312310	625..786	195	74.7	Plus

Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:10:18 has no hits.

Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:04:09

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3L	28110227	3L	8391544..8392380	3..839	4170	99.9	Plus
3L	28110227	3L	8392833..8393537	824..117	2165	87.6	Minus
2L	23513712	2L	4949973..4950749	795..16	1535	80.3	Minus
3R	32079331	3R	30487347..30487531	540..356	505	84.9	Minus
3R	32079331	3R	30489360..30489544	356..540	505	84.9	Plus
3R	32079331	3R	29922608..29922792	356..540	460	83.2	Plus
3R	32079331	3R	29924037..29924221	540..356	460	83.2	Minus
2L	23513712	2L	4954791..4955054	340..86	395	78.4	Minus
3L	28110227	3L	6053938..6054152	480..266	385	78.6	Minus
2L	23513712	2L	4954321..4954757	801..356	385	74	Minus
2R	25286936	2R	8691844..8692089	356..601	360	76.4	Plus
3L	28110227	3L	6052751..6052857	356..462	295	85	Plus
3R	32079331	3R	30489083..30489320	109..337	295	76.9	Plus
3R	32079331	3R	30487571..30487808	337..109	280	76.5	Minus
3R	32079331	3R	29924258..29924490	340..117	255	76	Minus
2L	23513712	2L	4952922..4953001	191..112	235	86.2	Minus
2R	25286936	2R	8691573..8691718	109..251	215	78.1	Plus
3R	32079331	3R	30487110..30487271	786..625	210	75.3	Minus

Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:43

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3L	28103327	3L	8384644..8385480	3..839	4170	99.8	Plus
3L	28103327	3L	8386179..8386637	572..117	1790	93	Minus
2L	23513712	2L	4950205..4950409	557..353	710	89.7	Minus
3L	28103327	3L	8385933..8386144	824..613	505	82.5	Minus
3R	31820162	3R	30230191..30230375	356..540	505	84.8	Plus
3R	31820162	3R	30228178..30228362	540..356	505	84.8	Minus
3R	31820162	3R	29663439..29663623	356..540	460	83.2	Plus
3R	31820162	3R	29664868..29665052	540..356	460	83.2	Minus
3L	28103327	3L	6047038..6047252	480..266	385	78.6	Minus
2L	23513712	2L	4950508..4950616	257..149	380	89.9	Minus
2L	23513712	2L	4954632..4954757	481..356	375	86.5	Minus
2R	25260384	2R	8693043..8693167	356..480	340	84.8	Plus
2L	23513712	2L	4954883..4955054	251..86	310	79.6	Minus
3L	28103327	3L	6045851..6045957	356..462	295	85	Plus
2L	23513712	2L	4949973..4950037	795..731	235	90.7	Minus
2L	23513712	2L	4952922..4953001	191..112	235	86.2	Minus
2L	23513712	2L	4950421..4950487	341..275	230	89.5	Minus
2L	23513712	2L	4954791..4954865	340..266	225	86.6	Minus
2L	23513712	2L	4954321..4954497	801..625	225	75.1	Minus
2R	25260384	2R	8692772..8692917	109..251	225	78	Plus
3R	31820162	3R	30229914..30229995	109..190	215	84.1	Plus
3R	31820162	3R	29665248..29665321	190..117	190	83.7	Minus
3R	31820162	3R	30228558..30228639	190..109	185	81.7	Minus
3R	31820162	3R	29663170..29663243	117..190	175	82.4	Plus
2L	23513712	2L	4950702..4950749	63..16	165	89.5	Minus
2L	23513712	2L	4952659..4952700	421..380	165	92.8	Minus
3L	28103327	3L	6044062..6044129	184..251	160	82.3	Plus
3L	28103327	3L	6046853..6046905	671..619	160	86.7	Minus
3R	31820162	3R	29663252..29663310	193..251	160	84.7	Plus
3R	31820162	3R	30228491..30228549	251..193	160	84.7	Minus
3R	31820162	3R	29665181..29665239	251..193	160	84.7	Minus
3L	28103327	3L	6046251..6046294	756..799	145	88.6	Plus
3R	31820162	3R	30227941..30228020	786..707	145	78.7	Minus
3R	31820162	3R	30230117..30230151	303..337	145	94.2	Plus
3R	31820162	3R	30230004..30230062	193..251	145	83	Plus
3R	31820162	3R	30228402..30228436	337..303	145	94.2	Minus
2R	25260384	2R	8693409..8693482	722..795	145	79.7	Plus
3L	28103327	3L	8386700..8386751	63..12	140	84.6	Minus
2L	23513712	2L	4952887..4952920	217..184	140	94.1	Minus

Blast to na_te.dros performed on 2019-03-16 09:04:10 has no hits.

RE64884.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:05:21 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
chr3L	8383564..8384399	1..836	99		Plus

Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:30:56 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	1..783	17..799	100		Plus

Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:26 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	1..783	17..799	100		Plus

Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:58:36 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	1..783	17..799	100		Plus

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:04 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	1..783	17..799	100		Plus

Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:49 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	1..783	17..799	100		Plus

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:18 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	1..836	1..836	99		Plus

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:26 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	1..836	1..836	99		Plus

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:58:36 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	3..838	1..836	99		Plus

Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:04 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	1..836	1..836	99		Plus

Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:49 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Jon66Ci-RA	3..838	1..836	99		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:21 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	8391542..8392377	1..836	99		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:21 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	8391542..8392377	1..836	99		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:21 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	8391542..8392377	1..836	99		Plus

Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:58:36 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
arm_3L	8384642..8385477	1..836	99		Plus

Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:13 Download gff for RE64884.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3L	8384642..8385477	1..836	99		Plus

RE64884.hyp Sequence

Translation from 0 to 798

> RE64884.hyp
SCFCNMKVFLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEE
GKAPYTVGLGFSGGWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRTN
AQFTHWVGSGNFITHGSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYN
EWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIIC
VRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVT
YHLDWIRDHTGIAYY*

RE64884.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:40

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Jon66Ci-PA	260	CG7118-PA	1..260	6..265	1454	100	Plus
Jon66Cii-PA	262	CG7170-PA	1..262	6..265	1198	82.2	Plus
Jon25Biii-PA	258	CG8871-PA	1..258	6..264	1179	82.3	Plus
Jon25Bi-PB	266	CG8867-PB	1..266	6..265	940	68.3	Plus
Jon99Fi-PA	267	CG18030-PA	4..267	10..264	871	63.1	Plus

RE64884.pep Sequence

Translation from 16 to 798

> RE64884.pep
MKVFLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPY
TVGLGFSGGWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRTNAQFTH
WVGSGNFITHGSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAV
ACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVD
GKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDW
IRDHTGIAYY*

RE64884.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:38:20

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dana\GF24394-PA	260	GF24394-PA	1..260	1..259	1200	90.8	Plus
Dana\GF21539-PA	258	GF21539-PA	1..258	1..259	1078	82.7	Plus
Dana\GF21537-PA	258	GF21537-PA	1..258	1..259	1056	81.9	Plus
Dana\GF21534-PA	268	GF21534-PA	1..268	1..260	854	64.2	Plus
Dana\GF10111-PA	186	GF10111-PA	20..186	93..259	806	88	Plus

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:38:20

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dere\GG14309-PA	260	GG14309-PA	1..260	1..260	1262	95	Plus
Dere\GG24338-PA	258	GG24338-PA	1..258	1..259	1052	81.5	Plus
Dere\GG24336-PA	266	GG24336-PA	1..266	1..260	887	66.5	Plus
Dere\GG11754-PA	267	GG11754-PA	30..267	29..259	791	66	Plus
Dere\GG11933-PA	267	GG11933-PA	30..267	29..259	790	66	Plus

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:38:21

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dgri\GH15026-PA	259	GH15026-PA	1..259	1..259	1030	77.3	Plus
Dgri\GH16447-PA	265	GH16447-PA	1..265	1..260	914	66.8	Plus
Dgri\GH16448-PA	267	GH16448-PA	23..267	21..260	894	68.6	Plus
Dgri\GH15028-PA	268	GH15028-PA	1..268	1..259	814	61.3	Plus
Dgri\GH12809-PA	260	GH12809-PA	1..260	1..259	635	49.2	Plus

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:20

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Jon66Ci-PA	260	CG7118-PA	1..260	1..260	1454	100	Plus
Jon66Cii-PA	262	CG7170-PA	1..262	1..260	1198	82.2	Plus
Jon25Biii-PA	258	CG8871-PA	1..258	1..259	1179	82.3	Plus
Jon25Bi-PB	266	CG8867-PB	1..266	1..260	940	68.3	Plus
Jon99Fi-PA	267	CG18030-PA	4..267	5..259	871	63.1	Plus
Jon99Fii-PA	267	CG2229-PA	1..267	1..259	870	62.5	Plus
Jon99Cii-PA	265	CG31034-PA	1..265	1..259	860	62.1	Plus
Jon99Ciii-PB	265	CG31362-PB	1..265	1..259	860	62.1	Plus
Jon99Ciii-PA	265	CG31362-PA	1..265	1..259	860	62.1	Plus
Jon44E-PB	271	CG8579-PB	1..271	1..259	841	58.3	Plus
Jon44E-PA	271	CG8579-PA	1..271	1..259	841	58.3	Plus
Jon25Bii-PB	276	CG8869-PB	1..276	1..259	838	57.6	Plus
Jon25Bii-PA	276	CG8869-PA	1..276	1..259	838	57.6	Plus
Jon65Ai-PB	262	CG10475-PB	1..262	1..259	821	58	Plus
Jon65Ai-PA	262	CG10475-PA	1..262	1..259	821	58	Plus
Jon65Aii-PA	259	CG6580-PA	1..259	1..259	745	54.5	Plus
Jon99Ci-PA	272	CG31039-PA	4..272	5..259	702	52.4	Plus
Jon65Aiii-PA	274	CG6483-PA	1..274	1..259	639	49.1	Plus
CG18180-PA	264	CG18180-PA	1..264	1..259	633	48.9	Plus
CG3088-PA	252	CG3088-PA	1..252	1..259	609	46.6	Plus
CG8329-PA	259	CG8329-PA	5..259	5..260	605	46.8	Plus
CG18179-PA	268	CG18179-PA	1..268	1..259	599	47.3	Plus
CG10477-PB	272	CG10477-PB	1..272	1..259	580	45.1	Plus
CG10477-PA	272	CG10477-PA	1..272	1..259	580	45.1	Plus
yip7-PA	270	CG6457-PA	1..270	1..257	565	47.8	Plus
Jon65Aiv-PA	271	CG6467-PA	3..271	4..257	548	45.4	Plus
CG10472-PA	290	CG10472-PA	45..285	35..257	408	40.5	Plus
CG7542-PB	270	CG7542-PB	23..263	33..254	390	40.1	Plus
CG7542-PA	270	CG7542-PA	23..263	33..254	390	40.1	Plus
CG6592-PA	438	CG6592-PA	111..364	25..258	327	36.1	Plus
Jon74E-PC	271	CG6298-PC	28..270	33..259	306	34.4	Plus
CG11529-PA	287	CG11529-PA	40..260	47..256	295	34.7	Plus
CG8952-PA	276	CG8952-PA	8..275	6..258	279	31.7	Plus
CG6462-PA	319	CG6462-PA	68..317	28..257	277	34.1	Plus
CG31954-PA	277	CG31954-PA	46..277	32..257	276	32.8	Plus
epsilonTry-PA	256	CG18681-PA	6..249	3..251	272	34.6	Plus
sphinx2-PC	253	CG32382-PC	21..253	32..259	271	28.5	Plus
sphinx2-PB	253	CG32382-PB	21..253	32..259	271	28.5	Plus
sphinx1-PB	253	CG32383-PB	1..253	1..259	270	26.3	Plus
CG18735-PA	364	CG18735-PA	82..315	36..255	259	31.4	Plus
CG5255-PA	273	CG5255-PA	1..256	3..258	258	30.8	Plus
l(2)k05911-PC	639	CG31728-PC	399..634	36..251	256	31.7	Plus
alphaTry-PA	256	CG18444-PA	26..249	32..251	248	32.5	Plus
Ser6-PA	259	CG2071-PA	23..259	28..257	247	30.4	Plus
CG11912-PA	271	CG11912-PA	1..267	1..254	245	31.8	Plus
CG3355-PA	314	CG3355-PA	75..311	36..260	244	31.4	Plus
CG5246-PA	272	CG5246-PA	1..261	1..251	242	32.2	Plus
CG17475-PB	288	CG17475-PB	35..268	27..252	239	33.9	Plus
CG17475-PA	288	CG17475-PA	35..268	27..252	239	33.9	Plus
CG1304-PA	260	CG1304-PA	13..259	4..257	237	29.6	Plus
CG4053-PB	265	CG4053-PB	1..259	1..256	237	31	Plus

Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:38:22

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dmoj\GI16680-PA	259	GI16680-PA	1..259	1..260	1190	85.8	Plus
Dmoj\GI16705-PA	258	GI16705-PA	1..258	1..260	1063	79.2	Plus
Dmoj\GI16704-PA	264	GI16704-PA	1..264	1..260	888	67	Plus
Dmoj\GI16703-PA	264	GI16703-PA	1..264	1..260	859	64.8	Plus
Dmoj\GI16681-PA	269	GI16681-PA	1..269	1..259	807	60.4	Plus

Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:38:22

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dper\GL24701-PA	239	GL24701-PA	1..239	22..259	1185	92.9	Plus
Dper\GL19488-PA	258	GL19488-PA	1..258	1..259	1065	81.5	Plus
Dper\GL26493-PA	265	GL26493-PA	1..265	1..259	857	65.3	Plus
Dper\GL26494-PA	276	GL26494-PA	1..276	1..259	835	60.9	Plus
Dper\GL13500-PA	265	GL13500-PA	21..265	22..259	784	63.3	Plus

Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:38:23

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dpse\GA20115-PA	260	GA20115-PA	1..260	1..259	1230	92.7	Plus
Dpse\GA21381-PA	258	GA21381-PA	1..258	1..259	1065	81.5	Plus
Dpse\GA21379-PA	265	GA21379-PA	1..265	1..259	857	65.3	Plus
Dpse\GA21380-PA	276	GA21380-PA	1..276	1..259	833	60.9	Plus
Dpse\GA10337-PA	262	GA10337-PA	1..262	1..259	793	59.5	Plus

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:38:24

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsec\GM25051-PA	260	GM25051-PA	1..260	1..260	1355	98.5	Plus
Dsec\GM24943-PA	262	GM24943-PA	1..262	1..260	1124	81.5	Plus
Dsec\GM18058-PA	252	GM18058-PA	1..252	1..259	974	75.8	Plus
Dsec\GM13875-PA	262	GM13875-PA	1..262	1..259	787	58.7	Plus
Dsec\GM12883-PA	229	GM12883-PA	13..229	49..259	692	63.3	Plus

Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:38:24

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsim\GD22676-PA	266	GD22676-PA	1..266	1..260	881	66.2	Plus
Dsim\GD12995-PA	235	GD12995-PA	1..224	1..222	879	75.4	Plus
Dsim\GD22678-PA	223	GD22678-PA	1..211	1..212	852	81.2	Plus
Dsim\GD21522-PA	267	GD21522-PA	30..267	29..259	792	64.7	Plus
Dsim\GD10590-PA	271	GD10590-PA	1..271	1..259	781	57.6	Plus

Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:38:25

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dvir\GJ11121-PA	258	GJ11121-PA	1..258	1..259	1082	86.5	Plus
Dvir\GJ12931-PA	258	GJ12931-PA	1..258	1..259	1082	86.5	Plus
Dvir\GJ12443-PA	257	GJ12443-PA	1..257	1..259	1056	77.7	Plus
Dvir\GJ12444-PA	266	GJ12444-PA	21..266	19..260	935	71.5	Plus
Dvir\GJ11123-PA	281	GJ11123-PA	1..281	1..260	862	62.8	Plus

Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:38:26

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dwil\GK17283-PA	263	GK17283-PA	1..263	1..260	1121	85.2	Plus
Dwil\GK17287-PA	262	GK17287-PA	20..262	15..259	1100	83.3	Plus
Dwil\GK16897-PA	259	GK16897-PA	1..259	1..259	1099	83	Plus
Dwil\GK17282-PA	259	GK17282-PA	1..259	1..259	1099	83	Plus
Dwil\GK17281-PA	259	GK17281-PA	1..259	1..259	1099	83	Plus

Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:38:26

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dyak\GE20738-PA	260	GE20738-PA	1..260	1..260	1348	97.7	Plus
Dyak\GE21311-PA	264	GE21311-PA	1..264	1..260	1165	83.7	Plus
Dyak\GE18717-PA	258	GE18717-PA	1..258	1..259	1065	81.9	Plus
Dyak\Ser4-PA	266	GE18715-PA	1..266	1..260	864	64.7	Plus
Dyak\GE23384-PA	265	GE23384-PA	29..265	30..259	790	65.8	Plus

Library:	RE
Tissue Source:	Drosophila melanogaster embryo
Created by:	Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:	2000-10-23
Comments:	Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:	648
Well:	84
Vector:	pFlc-1
Associated Gene/Transcript	Jon66Ci-RA
Protein status:	RE64884.pep: gold
Preliminary Size:	783
Sequenced Size:	851

Clone RE64884 Report

Clone and Library Details

Associated Genes

Clone Sequence Records

RE64884.complete Sequence

RE64884.complete Blast Records

RE64884.complete Sim4 Records

RE64884.hyp Sequence

RE64884.hyp Blast Records

RE64884.pep Sequence

RE64884.pep Blast Records