Clone RE65609 Report

Search the DGRC for RE65609

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:656
Well:9
Vector:pFlc-1
Associated Gene/TranscriptCG18619-RD
Protein status:RE65609.pep: gold
Sequenced Size:515

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18619-RD 2009-10-15 EST screening

Clone Sequence Records

RE65609.complete Sequence

515 bp assembled on 2009-10-29

GenBank Submission: BT100178.1

> RE65609.complete
ATTTTACGAAAGACGCATAATAACAAAGAGTTGCAAAGTTGTTGTATTAT
TTGAGAGTTATAATGGCTGATATGGAGATACAGAGCAACAAAATGTCAAT
AACGGAGGAAACACAAGTGCAGACGCGCAAGGAATGTGGAAAAAGGGGAC
GAAAACCAGGAAGAAAGACGTCTACTGAAAAATTGGACATGAAAGCCAAA
CTAGAACGCAGCAGACAAAGTGCCAGGGAATGCCGGGCGCGCAAGAAGCT
GCGGTATCAGTACCTGGAGGAACTGGTGGCGGATCGGGAGAAGGCTGTAG
TTGCTTTGCGTACGGAACTGGAGCGCGTCGTTAATTCAATGGAATAACCA
GTTGAGCGAAAGCAACACTCCAACCAACAATGACCAGTTACTTCAGGAAC
TCGGAATCCTCAAACAAGAATAACCTACATTCTTATTTTTAGCTTAAGAA
TATTACTTTTATAATAAATGTACGACGGTTACTATTTATATTATTACGGA
AAAAAAAAAAAAAAA

RE65609.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-RD 658 CG18619-RD 48..547 3..502 2485 99.8 Plus
CG18619-RC 713 CG18619-RC 68..564 3..502 2415 99.2 Plus
CG18619-RA 712 CG18619-RA 68..563 3..502 2400 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10263802..10263970 330..498 845 100 Plus
chr2L 23010047 chr2L 10263618..10263745 203..330 640 100 Plus
chr2L 23010047 chr2L 10263004..10263120 3..119 585 100 Plus
chr2L 23010047 chr2L 10263404..10263489 119..204 430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:10:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10264946..10265118 330..502 850 99.4 Plus
2L 23513712 2L 10264762..10264889 203..330 640 100 Plus
2L 23513712 2L 10264148..10264264 3..119 585 100 Plus
2L 23513712 2L 10264548..10264633 119..204 430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10264946..10265118 330..502 850 99.4 Plus
2L 23513712 2L 10264762..10264889 203..330 640 100 Plus
2L 23513712 2L 10264148..10264264 3..119 585 100 Plus
2L 23513712 2L 10264548..10264633 119..204 430 100 Plus
Blast to na_te.dros performed 2019-03-16 05:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Burdock 6411 Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). 5561..5615 493..438 106 67.9 Minus

RE65609.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:03:00 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10263405..10263489 120..204 100 -> Plus
chr2L 10263620..10263745 205..330 100 -> Plus
chr2L 10263803..10263970 331..499 99   Plus
chr2L 10263003..10263120 1..119 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-29 10:40:07 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RA 1..357 63..423 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:14:32 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RA 1..357 63..423 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:14 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RA 1..357 63..423 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:53:43 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RA 1..357 63..423 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-29 10:40:05 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RD 17..513 1..499 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:14:32 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RD 17..513 1..499 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:14 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RD 23..519 1..499 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:53:43 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RD 23..519 1..499 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:00 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264147..10264264 1..119 99 -> Plus
2L 10264549..10264633 120..204 100 -> Plus
2L 10264764..10264889 205..330 100 -> Plus
2L 10264947..10265114 331..499 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:00 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264147..10264264 1..119 99 -> Plus
2L 10264549..10264633 120..204 100 -> Plus
2L 10264764..10264889 205..330 100 -> Plus
2L 10264947..10265114 331..499 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:00 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264147..10264264 1..119 99 -> Plus
2L 10264549..10264633 120..204 100 -> Plus
2L 10264764..10264889 205..330 100 -> Plus
2L 10264947..10265114 331..499 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:14 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10264947..10265114 331..499 99   Plus
arm_2L 10264147..10264264 1..119 99 -> Plus
arm_2L 10264549..10264633 120..204 100 -> Plus
arm_2L 10264764..10264889 205..330 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:51 Download gff for RE65609.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264764..10264889 205..330 100 -> Plus
2L 10264147..10264264 1..119 99 -> Plus
2L 10264549..10264633 120..204 100 -> Plus
2L 10264947..10265114 331..499 99   Plus

RE65609.hyp Sequence

Translation from 62 to 346

> RE65609.hyp
MADMEIQSNKMSITEETQVQTRKECGKRGRKPGRKTSTEKLDMKAKLERS
RQSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSME*

RE65609.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-PD 94 CG18619-PD 1..94 1..94 464 100 Plus
CG18619-PC 93 CG18619-PC 1..93 1..94 447 98.9 Plus
CG18619-PA 118 CG18619-PA 1..90 1..90 440 97.8 Plus
CG18619-PB 117 CG18619-PB 1..89 1..90 423 96.7 Plus

RE65609.pep Sequence

Translation from 62 to 346

> RE65609.pep
MADMEIQSNKMSITEETQVQTRKECGKRGRKPGRKTSTEKLDMKAKLERS
RQSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSME*

RE65609.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15758-PA 93 GF15758-PA 1..93 1..94 411 89.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10098-PA 117 GG10098-PA 1..89 1..90 427 95.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13018-PA 118 GH13018-PA 1..87 4..90 345 78.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
REPTOR-BP-PD 94 CG18619-PD 1..94 1..94 464 100 Plus
REPTOR-BP-PC 93 CG18619-PC 1..93 1..94 447 98.9 Plus
REPTOR-BP-PA 118 CG18619-PA 1..90 1..90 440 97.8 Plus
REPTOR-BP-PB 117 CG18619-PB 1..89 1..90 423 96.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18265-PA 118 GI18265-PA 1..87 4..90 344 78.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19008-PA 115 GL19008-PA 1..87 4..90 371 83.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15016-PA 108 GA15016-PA 1..80 11..90 345 85 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18070-PA 94 GM18070-PA 1..94 1..94 452 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23670-PA 94 GD23670-PA 1..94 1..94 459 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17525-PA 118 GJ17525-PA 1..88 4..91 346 77.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23539-PA 111 GK23539-PA 1..80 11..90 339 82.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18912-PA 117 GE18912-PA 1..89 1..90 423 94.4 Plus