BDGP Sequence Production Resources |
Search the DGRC for RE65609
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 656 |
Well: | 9 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG18619-RD |
Protein status: | RE65609.pep: gold |
Sequenced Size: | 515 |
Gene | Date | Evidence |
---|---|---|
CG18619-RD | 2009-10-15 | EST screening |
515 bp assembled on 2009-10-29
GenBank Submission: BT100178.1
> RE65609.complete ATTTTACGAAAGACGCATAATAACAAAGAGTTGCAAAGTTGTTGTATTAT TTGAGAGTTATAATGGCTGATATGGAGATACAGAGCAACAAAATGTCAAT AACGGAGGAAACACAAGTGCAGACGCGCAAGGAATGTGGAAAAAGGGGAC GAAAACCAGGAAGAAAGACGTCTACTGAAAAATTGGACATGAAAGCCAAA CTAGAACGCAGCAGACAAAGTGCCAGGGAATGCCGGGCGCGCAAGAAGCT GCGGTATCAGTACCTGGAGGAACTGGTGGCGGATCGGGAGAAGGCTGTAG TTGCTTTGCGTACGGAACTGGAGCGCGTCGTTAATTCAATGGAATAACCA GTTGAGCGAAAGCAACACTCCAACCAACAATGACCAGTTACTTCAGGAAC TCGGAATCCTCAAACAAGAATAACCTACATTCTTATTTTTAGCTTAAGAA TATTACTTTTATAATAAATGTACGACGGTTACTATTTATATTATTACGGA AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 10263802..10263970 | 330..498 | 845 | 100 | Plus |
chr2L | 23010047 | chr2L | 10263618..10263745 | 203..330 | 640 | 100 | Plus |
chr2L | 23010047 | chr2L | 10263004..10263120 | 3..119 | 585 | 100 | Plus |
chr2L | 23010047 | chr2L | 10263404..10263489 | 119..204 | 430 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10264946..10265118 | 330..502 | 850 | 99.4 | Plus |
2L | 23513712 | 2L | 10264762..10264889 | 203..330 | 640 | 100 | Plus |
2L | 23513712 | 2L | 10264148..10264264 | 3..119 | 585 | 100 | Plus |
2L | 23513712 | 2L | 10264548..10264633 | 119..204 | 430 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10264946..10265118 | 330..502 | 850 | 99.4 | Plus |
2L | 23513712 | 2L | 10264762..10264889 | 203..330 | 640 | 100 | Plus |
2L | 23513712 | 2L | 10264148..10264264 | 3..119 | 585 | 100 | Plus |
2L | 23513712 | 2L | 10264548..10264633 | 119..204 | 430 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Burdock | 6411 | Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). | 5561..5615 | 493..438 | 106 | 67.9 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 10263405..10263489 | 120..204 | 100 | -> | Plus |
chr2L | 10263620..10263745 | 205..330 | 100 | -> | Plus |
chr2L | 10263803..10263970 | 331..499 | 99 | Plus | |
chr2L | 10263003..10263120 | 1..119 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RA | 1..357 | 63..423 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RA | 1..357 | 63..423 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RA | 1..357 | 63..423 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RA | 1..357 | 63..423 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RD | 17..513 | 1..499 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RD | 17..513 | 1..499 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RD | 23..519 | 1..499 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RD | 23..519 | 1..499 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264147..10264264 | 1..119 | 99 | -> | Plus |
2L | 10264549..10264633 | 120..204 | 100 | -> | Plus |
2L | 10264764..10264889 | 205..330 | 100 | -> | Plus |
2L | 10264947..10265114 | 331..499 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264147..10264264 | 1..119 | 99 | -> | Plus |
2L | 10264549..10264633 | 120..204 | 100 | -> | Plus |
2L | 10264764..10264889 | 205..330 | 100 | -> | Plus |
2L | 10264947..10265114 | 331..499 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264147..10264264 | 1..119 | 99 | -> | Plus |
2L | 10264549..10264633 | 120..204 | 100 | -> | Plus |
2L | 10264764..10264889 | 205..330 | 100 | -> | Plus |
2L | 10264947..10265114 | 331..499 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 10264947..10265114 | 331..499 | 99 | Plus | |
arm_2L | 10264147..10264264 | 1..119 | 99 | -> | Plus |
arm_2L | 10264549..10264633 | 120..204 | 100 | -> | Plus |
arm_2L | 10264764..10264889 | 205..330 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264764..10264889 | 205..330 | 100 | -> | Plus |
2L | 10264147..10264264 | 1..119 | 99 | -> | Plus |
2L | 10264549..10264633 | 120..204 | 100 | -> | Plus |
2L | 10264947..10265114 | 331..499 | 99 | Plus |
Translation from 62 to 346
> RE65609.hyp MADMEIQSNKMSITEETQVQTRKECGKRGRKPGRKTSTEKLDMKAKLERS RQSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSME*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18619-PD | 94 | CG18619-PD | 1..94 | 1..94 | 464 | 100 | Plus |
CG18619-PC | 93 | CG18619-PC | 1..93 | 1..94 | 447 | 98.9 | Plus |
CG18619-PA | 118 | CG18619-PA | 1..90 | 1..90 | 440 | 97.8 | Plus |
CG18619-PB | 117 | CG18619-PB | 1..89 | 1..90 | 423 | 96.7 | Plus |
Translation from 62 to 346
> RE65609.pep MADMEIQSNKMSITEETQVQTRKECGKRGRKPGRKTSTEKLDMKAKLERS RQSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSME*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15758-PA | 93 | GF15758-PA | 1..93 | 1..94 | 411 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10098-PA | 117 | GG10098-PA | 1..89 | 1..90 | 427 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13018-PA | 118 | GH13018-PA | 1..87 | 4..90 | 345 | 78.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
REPTOR-BP-PD | 94 | CG18619-PD | 1..94 | 1..94 | 464 | 100 | Plus |
REPTOR-BP-PC | 93 | CG18619-PC | 1..93 | 1..94 | 447 | 98.9 | Plus |
REPTOR-BP-PA | 118 | CG18619-PA | 1..90 | 1..90 | 440 | 97.8 | Plus |
REPTOR-BP-PB | 117 | CG18619-PB | 1..89 | 1..90 | 423 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18265-PA | 118 | GI18265-PA | 1..87 | 4..90 | 344 | 78.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19008-PA | 115 | GL19008-PA | 1..87 | 4..90 | 371 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15016-PA | 108 | GA15016-PA | 1..80 | 11..90 | 345 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18070-PA | 94 | GM18070-PA | 1..94 | 1..94 | 452 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23670-PA | 94 | GD23670-PA | 1..94 | 1..94 | 459 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17525-PA | 118 | GJ17525-PA | 1..88 | 4..91 | 346 | 77.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23539-PA | 111 | GK23539-PA | 1..80 | 11..90 | 339 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18912-PA | 117 | GE18912-PA | 1..89 | 1..90 | 423 | 94.4 | Plus |