Clone RE65629 Report

Search the DGRC for RE65629

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:656
Well:29
Vector:pFlc-1
Associated Gene/Transcriptkoko-RB
Protein status:RE65629.pep: gold
Sequenced Size:1257

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31232 2004-03-31 Blastp of sequenced clone
koko 2008-04-29 Release 5.5 accounting
koko 2008-08-15 Release 5.9 accounting
koko 2008-12-18 5.12 accounting

Clone Sequence Records

RE65629.complete Sequence

1257 bp (1257 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012450

> RE65629.complete
CATTACAGCGCTGCAGCCCAATCAAACCGGTTTGTCGCCTTTCGACTTTT
CGGTGGTCTCAGTTCACATCCATTTCCCCAACCAGTCCAATTGCTTTTAT
CTTGCTCCTCGAGTGTTAACGAAATTGCTTAAATCCACCCACATTCATCC
TTTCATTCAGTTCGGCCTGGGAGTAGCAGCATGAAAAACGTTTTGGATGT
CATGTCGATGCAGCAGCACGTGGAGTTGAACAAGGCGCAGACCATGAAGC
CCATCGACTATCGCAAAATGAACAAACCCGGCGTGGTGCCGATGTACATC
TTTGAGTGCGCTGCCAAGTTGAAAATGAAACCGCTGACGGCGGCCTGTGC
GGCCATAGTGTTCCATCGCTTCTTCCGCGAGGTCAAGGCCAGCGACTACG
ATGAGTTCCTCATTGCCGCGGGCTCGCTGTACTTGGCTGGCAAAATTAAG
GAAGACGAAAGTGTCAAGATACGCGATGTCATCAACGTGGCATACTGCAC
CCTTAACCGGGGCAATGATCCAGTCGACCTGAACGATGAGTACTGGTCGA
TGCGGGATGCCATTGTCCAGGCTGAGCTGCTCATCACGCGCACCCTGTGC
TTCGATCTCAACATAGATCTGGCCCACAAGTACTTACTCCACTACATGAA
GACCCTACAAGACTGGGTGGGCACTGAGGTGTGGAACTCGGTGCCCATTG
CCAAGGCAGCCGCCTCGTATCTGCAAGACTTTCACCACAGCGCCAATATC
CTCAAGTACAAGCCCACCCATGTGGCCATTGGGTGCCTGTCGCTGGCCCT
CCAGACCTACGGCATCCAGGTGCCGCTAACCGACGAGTCCGACGAATCCG
CCATGTGGTACAAGCCCTTGGTCAAGGACTTCACCCGAGAGAACCAGTGG
GAGATCATCGAGAACGTGATCGAGGTCTACAAGAACGAGGGCTTCCTGAA
TGCCACCTAATCGCTGAGAGAGACTGCCAAAACCATTCCTTCTGCCATCT
GAACTTATTTATTTTCCCCTCGCCACCTCATAAACCAATCTCAGATACTA
CTAGACGTACATATGCTCAAATGTCCAATGCATTTACATCATGCCCTTGC
CAAAACAAATAAATTGACCGGTAATGAAATGCTTATGTGATCGACGGGCG
AAAGTACATTTACCTATCAGCGAAGACGATAGATCTAAAGTTTACAACTT
ATTTATACACTGATTCAATAAACAATTGTTCTGTGAAAAATCAAAAAAAA
AAAAAAA

RE65629.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
koko-RB 1351 koko-RB 39..1279 1..1241 6205 100 Plus
koko-RC 1317 koko-RC 164..1245 160..1241 5410 100 Plus
koko-RE 1223 koko-RE 70..1151 160..1241 5410 100 Plus
koko-RC 1317 koko-RC 136..164 1..29 145 100 Plus
koko-RE 1223 koko-RE 42..70 1..29 145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14228092..14228924 409..1241 4165 100 Plus
chr3R 27901430 chr3R 14227558..14227820 1..263 1315 100 Plus
chr3R 27901430 chr3R 14227886..14228031 263..408 730 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:10:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18403894..18404726 409..1241 4165 100 Plus
3R 32079331 3R 18403360..18403622 1..263 1315 100 Plus
3R 32079331 3R 18403688..18403833 263..408 730 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18144725..18145557 409..1241 4165 100 Plus
3R 31820162 3R 18144191..18144453 1..263 1315 100 Plus
3R 31820162 3R 18144519..18144664 263..408 730 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:34:10 has no hits.

RE65629.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:35:13 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14227558..14227820 1..263 100 -> Plus
chr3R 14227887..14228031 264..408 100 -> Plus
chr3R 14228092..14228924 409..1242 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:31:30 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RA 491..1302 147..960 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:37:31 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RA 491..1302 147..960 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:21:16 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RC 1..780 181..960 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:21:18 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RA 491..1302 147..960 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:51:48 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RC 1..780 181..960 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:45:12 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RB 1..1241 1..1241 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:37:31 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RB 1..1241 1..1241 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:21:16 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RB 39..1279 1..1241 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:21:18 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RB 1..1241 1..1241 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:51:48 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
koko-RB 39..1279 1..1241 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:13 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18403360..18403622 1..263 100 -> Plus
3R 18403689..18403833 264..408 100 -> Plus
3R 18403894..18404726 409..1242 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:13 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18403360..18403622 1..263 100 -> Plus
3R 18403689..18403833 264..408 100 -> Plus
3R 18403894..18404726 409..1242 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:13 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18403360..18403622 1..263 100 -> Plus
3R 18403689..18403833 264..408 100 -> Plus
3R 18403894..18404726 409..1242 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:21:16 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14229082..14229344 1..263 100 -> Plus
arm_3R 14229411..14229555 264..408 100 -> Plus
arm_3R 14229616..14230448 409..1242 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:58:43 Download gff for RE65629.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18144191..18144453 1..263 100 -> Plus
3R 18144520..18144664 264..408 100 -> Plus
3R 18144725..18145557 409..1242 99   Plus

RE65629.pep Sequence

Translation from 180 to 959

> RE65629.pep
MKNVLDVMSMQQHVELNKAQTMKPIDYRKMNKPGVVPMYIFECAAKLKMK
PLTAACAAIVFHRFFREVKASDYDEFLIAAGSLYLAGKIKEDESVKIRDV
INVAYCTLNRGNDPVDLNDEYWSMRDAIVQAELLITRTLCFDLNIDLAHK
YLLHYMKTLQDWVGTEVWNSVPIAKAAASYLQDFHHSANILKYKPTHVAI
GCLSLALQTYGIQVPLTDESDESAMWYKPLVKDFTRENQWEIIENVIEVY
KNEGFLNAT*

RE65629.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16903-PA 259 GF16903-PA 1..258 1..258 1288 91.9 Plus
Dana\GF15386-PA 402 GF15386-PA 27..241 28..252 161 23.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22891-PA 265 GG22891-PA 83..264 77..258 930 95.1 Plus
Dere\GG21466-PA 401 GG21466-PA 27..241 28..252 166 23.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21374-PA 259 GH21374-PA 1..259 1..259 1223 85.3 Plus
Dgri\GH10982-PA 434 GH10982-PA 27..241 28..252 161 23.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
koko-PE 259 CG44010-PE 1..259 1..259 1361 100 Plus
koko-PD 259 CG44010-PD 1..259 1..259 1361 100 Plus
koko-PC 259 CG44010-PC 1..259 1..259 1361 100 Plus
koko-PB 259 CG44010-PB 1..259 1..259 1361 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18550-PA 259 GI18550-PA 1..258 1..258 1222 86 Plus
Dmoj\GI17494-PA 415 GI17494-PA 27..241 28..252 160 23.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24344-PA 253 GL24344-PA 1..252 8..258 1199 86.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30142-PC 353 GA30142-PC 123..352 29..258 1130 88.7 Plus
Dpse\GA13578-PA 423 GA13578-PA 28..242 28..252 162 23.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17868-PA 426 GM17868-PA 168..289 79..202 576 90.3 Plus
Dsec\GM16115-PA 400 GM16115-PA 27..241 28..252 164 23.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19230-PA 350 GD19230-PA 168..350 77..259 989 99.5 Plus
Dsim\GD21618-PA 400 GD21618-PA 27..241 28..252 164 23.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20344-PA 259 GJ20344-PA 1..259 1..259 1233 86.5 Plus
Dvir\GJ15154-PA 425 GJ15154-PA 27..241 28..252 160 23.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13086-PA 259 GK13086-PA 1..258 1..258 1238 88 Plus
Dwil\GK15351-PA 421 GK15351-PA 27..241 28..252 159 23.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25539-PA 375 GE25539-PA 117..375 1..259 1324 94.6 Plus
Dyak\GE12968-PA 402 GE12968-PA 27..241 28..252 165 23.2 Plus

RE65629.hyp Sequence

Translation from 180 to 959

> RE65629.hyp
MKNVLDVMSMQQHVELNKAQTMKPIDYRKMNKPGVVPMYIFECAAKLKMK
PLTAACAAIVFHRFFREVKASDYDEFLIAAGSLYLAGKIKEDESVKIRDV
INVAYCTLNRGNDPVDLNDEYWSMRDAIVQAELLITRTLCFDLNIDLAHK
YLLHYMKTLQDWVGTEVWNSVPIAKAAASYLQDFHHSANILKYKPTHVAI
GCLSLALQTYGIQVPLTDESDESAMWYKPLVKDFTRENQWEIIENVIEVY
KNEGFLNAT*

RE65629.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
koko-PE 259 CG44010-PE 1..259 1..259 1361 100 Plus
koko-PD 259 CG44010-PD 1..259 1..259 1361 100 Plus
koko-PC 259 CG44010-PC 1..259 1..259 1361 100 Plus
koko-PB 259 CG44010-PB 1..259 1..259 1361 100 Plus