BDGP Sequence Production Resources |
Search the DGRC for RE65766
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 657 |
Well: | 66 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL40-RA |
Protein status: | RE65766.pep: gold |
Preliminary Size: | 647 |
Sequenced Size: | 736 |
Gene | Date | Evidence |
---|---|---|
CG5242 | 2001-12-14 | Blastp of sequenced clone |
CG5242 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5242 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL40 | 2008-04-29 | Release 5.5 accounting |
mRpL40 | 2008-08-15 | Release 5.9 accounting |
mRpL40 | 2008-12-18 | 5.12 accounting |
736 bp (736 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071609
> RE65766.complete ATTGAACAGCAACAAAAACAGCTGTTCGTACATTACGCAAAGGTTTTTTC CACATTTGTTTATTAAAAATGTCGCTGCTGGGCGCCTTTGCCAGATTGAG TCTGCAGAGAAGTGGCGGCGTCGCCGGTGCCGCCTTTGCACGTTGCCTCC ACACGACACCAGTTCTTTGTGCGGAGCCCCTGAAGAAAAAGAAGAAACTG GATCCGCAGATTGTCAAGCAGCGCGAGGATCGCAAGAAGAAGAAGATCGA AAAGCAGATTCGCCGGCTGGAGAAGAATGCCCGTCAGCTGAAGCCCGTGG ATGAACTGGAGGTTCCACTGGAGCTCATCGACGAAAAGGACAAACGGCAG CGGAAGCTAGCTCCACTGACCATCGACCAGTTGGAGGAACGTGCTCTCCT CAAGAAGCAGTGGGCGCACTACAAGCACGACGAGCGCGTAGCAGACTTTC AGATCATCGACCGGCTGGTCCAGGCGCAAAACAAGGCGCTGGCGGAACTT CGGCGCGAGTCCGAGGAGCTCTACCAGGCGGCCATCGATATCGATCCCCA GCTGCTGCCCGTCGCCGTCAAAGGACCCGTTGCCACGCCCCCCATTAAGG ATTACGTCAGTCCCGATGGCGACTACCTGCACCAATCCATGAAGTGGGAG GTCAAATGAGGCGTGTAAGTTCCGGATGTTAAAGATTTGAAATAAACTGA ACCCTAATCCTAAAAAAAAGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL40-RA | 856 | mRpL40-RA | 76..787 | 1..712 | 3560 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 7233856..7234227 | 341..712 | 1860 | 100 | Plus |
chr3R | 27901430 | chr3R | 7233548..7233796 | 92..340 | 1230 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 7233393..7233486 | 1..94 | 455 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 11149217..11149588 | 341..712 | 1860 | 100 | Plus |
3R | 31820162 | 3R | 11148909..11149157 | 92..340 | 1245 | 100 | Plus |
3R | 31820162 | 3R | 11148754..11148847 | 1..94 | 470 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 7233393..7233486 | 1..94 | 98 | -> | Plus |
chr3R | 7233551..7233796 | 95..340 | 99 | -> | Plus |
chr3R | 7233856..7234227 | 341..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 1..591 | 69..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 1..591 | 69..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 1..591 | 69..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 1..591 | 69..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 1..591 | 69..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 1..715 | 1..715 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 27..737 | 1..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 6..716 | 1..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 1..715 | 1..715 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL40-RA | 6..716 | 1..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11407923..11408016 | 1..94 | 100 | -> | Plus |
3R | 11408081..11408326 | 95..340 | 100 | -> | Plus |
3R | 11408386..11408757 | 341..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11407923..11408016 | 1..94 | 100 | -> | Plus |
3R | 11408081..11408326 | 95..340 | 100 | -> | Plus |
3R | 11408386..11408757 | 341..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11407923..11408016 | 1..94 | 100 | -> | Plus |
3R | 11408081..11408326 | 95..340 | 100 | -> | Plus |
3R | 11408386..11408757 | 341..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 7233803..7234048 | 95..340 | 100 | -> | Plus |
arm_3R | 7233645..7233738 | 1..94 | 100 | -> | Plus |
arm_3R | 7234108..7234479 | 341..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11148912..11149157 | 95..340 | 100 | -> | Plus |
3R | 11149217..11149588 | 341..712 | 100 | Plus | |
3R | 11148754..11148847 | 1..94 | 100 | -> | Plus |
Translation from 68 to 658
> RE65766.hyp MSLLGAFARLSLQRSGGVAGAAFARCLHTTPVLCAEPLKKKKKLDPQIVK QREDRKKKKIEKQIRRLEKNARQLKPVDELEVPLELIDEKDKRQRKLAPL TIDQLEERALLKKQWAHYKHDERVADFQIIDRLVQAQNKALAELRRESEE LYQAAIDIDPQLLPVAVKGPVATPPIKDYVSPDGDYLHQSMKWEVK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL40-PA | 196 | CG5242-PA | 1..196 | 1..196 | 997 | 100 | Plus |
Translation from 68 to 658
> RE65766.pep MSLLGAFARLSLQRSGGVAGAAFARCLHTTPVLCAEPLKKKKKLDPQIVK QREDRKKKKIEKQIRRLEKNARQLKPVDELEVPLELIDEKDKRQRKLAPL TIDQLEERALLKKQWAHYKHDERVADFQIIDRLVQAQNKALAELRRESEE LYQAAIDIDPQLLPVAVKGPVATPPIKDYVSPDGDYLHQSMKWEVK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16858-PA | 198 | GF16858-PA | 1..198 | 1..196 | 861 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18100-PA | 196 | GG18100-PA | 1..196 | 1..196 | 899 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21548-PA | 189 | GH21548-PA | 1..189 | 1..194 | 686 | 79.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL40-PA | 196 | CG5242-PA | 1..196 | 1..196 | 997 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22697-PA | 189 | GI22697-PA | 13..189 | 14..194 | 706 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11999-PA | 193 | GL11999-PA | 1..193 | 1..194 | 769 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18758-PA | 193 | GA18758-PA | 1..193 | 1..194 | 772 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23940-PA | 196 | GM23940-PA | 1..196 | 1..196 | 931 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18750-PA | 196 | GD18750-PA | 1..196 | 1..196 | 927 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23425-PA | 189 | GJ23425-PA | 1..189 | 1..194 | 693 | 79.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11291-PA | 189 | GK11291-PA | 1..189 | 1..194 | 740 | 79.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26091-PA | 196 | GE26091-PA | 1..196 | 1..196 | 928 | 95.9 | Plus |