Clone RE65766 Report

Search the DGRC for RE65766

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:657
Well:66
Vector:pFlc-1
Associated Gene/TranscriptmRpL40-RA
Protein status:RE65766.pep: gold
Preliminary Size:647
Sequenced Size:736

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5242 2001-12-14 Blastp of sequenced clone
CG5242 2002-01-01 Sim4 clustering to Release 2
CG5242 2003-01-01 Sim4 clustering to Release 3
mRpL40 2008-04-29 Release 5.5 accounting
mRpL40 2008-08-15 Release 5.9 accounting
mRpL40 2008-12-18 5.12 accounting

Clone Sequence Records

RE65766.complete Sequence

736 bp (736 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071609

> RE65766.complete
ATTGAACAGCAACAAAAACAGCTGTTCGTACATTACGCAAAGGTTTTTTC
CACATTTGTTTATTAAAAATGTCGCTGCTGGGCGCCTTTGCCAGATTGAG
TCTGCAGAGAAGTGGCGGCGTCGCCGGTGCCGCCTTTGCACGTTGCCTCC
ACACGACACCAGTTCTTTGTGCGGAGCCCCTGAAGAAAAAGAAGAAACTG
GATCCGCAGATTGTCAAGCAGCGCGAGGATCGCAAGAAGAAGAAGATCGA
AAAGCAGATTCGCCGGCTGGAGAAGAATGCCCGTCAGCTGAAGCCCGTGG
ATGAACTGGAGGTTCCACTGGAGCTCATCGACGAAAAGGACAAACGGCAG
CGGAAGCTAGCTCCACTGACCATCGACCAGTTGGAGGAACGTGCTCTCCT
CAAGAAGCAGTGGGCGCACTACAAGCACGACGAGCGCGTAGCAGACTTTC
AGATCATCGACCGGCTGGTCCAGGCGCAAAACAAGGCGCTGGCGGAACTT
CGGCGCGAGTCCGAGGAGCTCTACCAGGCGGCCATCGATATCGATCCCCA
GCTGCTGCCCGTCGCCGTCAAAGGACCCGTTGCCACGCCCCCCATTAAGG
ATTACGTCAGTCCCGATGGCGACTACCTGCACCAATCCATGAAGTGGGAG
GTCAAATGAGGCGTGTAAGTTCCGGATGTTAAAGATTTGAAATAAACTGA
ACCCTAATCCTAAAAAAAAGAAAAAAAAAAAAAAAA

RE65766.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL40-RA 856 mRpL40-RA 76..787 1..712 3560 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7233856..7234227 341..712 1860 100 Plus
chr3R 27901430 chr3R 7233548..7233796 92..340 1230 99.6 Plus
chr3R 27901430 chr3R 7233393..7233486 1..94 455 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:10:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11408386..11408757 341..712 1860 100 Plus
3R 32079331 3R 11408078..11408326 92..340 1245 100 Plus
3R 32079331 3R 11407923..11408016 1..94 470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11149217..11149588 341..712 1860 100 Plus
3R 31820162 3R 11148909..11149157 92..340 1245 100 Plus
3R 31820162 3R 11148754..11148847 1..94 470 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:02:47 has no hits.

RE65766.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:03:37 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7233393..7233486 1..94 98 -> Plus
chr3R 7233551..7233796 95..340 99 -> Plus
chr3R 7233856..7234227 341..712 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:31:35 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 1..591 69..659 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:55 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 1..591 69..659 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:25:52 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 1..591 69..659 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:09 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 1..591 69..659 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:07 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 1..591 69..659 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:42:25 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 1..715 1..715 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:54 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 27..737 1..711 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:52 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 6..716 1..711 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:09 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 1..715 1..715 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:07 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL40-RA 6..716 1..711 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:37 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11407923..11408016 1..94 100 -> Plus
3R 11408081..11408326 95..340 100 -> Plus
3R 11408386..11408757 341..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:37 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11407923..11408016 1..94 100 -> Plus
3R 11408081..11408326 95..340 100 -> Plus
3R 11408386..11408757 341..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:37 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11407923..11408016 1..94 100 -> Plus
3R 11408081..11408326 95..340 100 -> Plus
3R 11408386..11408757 341..712 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:52 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7233803..7234048 95..340 100 -> Plus
arm_3R 7233645..7233738 1..94 100 -> Plus
arm_3R 7234108..7234479 341..712 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:13:30 Download gff for RE65766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11148912..11149157 95..340 100 -> Plus
3R 11149217..11149588 341..712 100   Plus
3R 11148754..11148847 1..94 100 -> Plus

RE65766.hyp Sequence

Translation from 68 to 658

> RE65766.hyp
MSLLGAFARLSLQRSGGVAGAAFARCLHTTPVLCAEPLKKKKKLDPQIVK
QREDRKKKKIEKQIRRLEKNARQLKPVDELEVPLELIDEKDKRQRKLAPL
TIDQLEERALLKKQWAHYKHDERVADFQIIDRLVQAQNKALAELRRESEE
LYQAAIDIDPQLLPVAVKGPVATPPIKDYVSPDGDYLHQSMKWEVK*

RE65766.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL40-PA 196 CG5242-PA 1..196 1..196 997 100 Plus

RE65766.pep Sequence

Translation from 68 to 658

> RE65766.pep
MSLLGAFARLSLQRSGGVAGAAFARCLHTTPVLCAEPLKKKKKLDPQIVK
QREDRKKKKIEKQIRRLEKNARQLKPVDELEVPLELIDEKDKRQRKLAPL
TIDQLEERALLKKQWAHYKHDERVADFQIIDRLVQAQNKALAELRRESEE
LYQAAIDIDPQLLPVAVKGPVATPPIKDYVSPDGDYLHQSMKWEVK*

RE65766.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16858-PA 198 GF16858-PA 1..198 1..196 861 88.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18100-PA 196 GG18100-PA 1..196 1..196 899 91.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21548-PA 189 GH21548-PA 1..189 1..194 686 79.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL40-PA 196 CG5242-PA 1..196 1..196 997 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22697-PA 189 GI22697-PA 13..189 14..194 706 79.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11999-PA 193 GL11999-PA 1..193 1..194 769 85.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18758-PA 193 GA18758-PA 1..193 1..194 772 85.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23940-PA 196 GM23940-PA 1..196 1..196 931 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18750-PA 196 GD18750-PA 1..196 1..196 927 95.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23425-PA 189 GJ23425-PA 1..189 1..194 693 79.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11291-PA 189 GK11291-PA 1..189 1..194 740 79.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26091-PA 196 GE26091-PA 1..196 1..196 928 95.9 Plus