BDGP Sequence Production Resources |
Search the DGRC for RE65906
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 659 |
Well: | 6 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG14569-RA |
Protein status: | RE65906.pep: gold |
Preliminary Size: | 588 |
Sequenced Size: | 839 |
Gene | Date | Evidence |
---|---|---|
CG14569 | 2001-12-14 | Blastp of sequenced clone |
CG14569 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14569 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14569 | 2008-04-29 | Release 5.5 accounting |
CG14569 | 2008-08-15 | Release 5.9 accounting |
CG14569 | 2008-12-18 | 5.12 accounting |
839 bp (839 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071610
> RE65906.complete AGAACAGAAGCCCTTCAACCGCGAAAATGTTTAAACCGACTGGCGCACCA ATTGCTATTCTTGTCCTGAGCCTGTTGGCGCTGAGCTCCGCGGAGCCGAT CCGCCGGAGGTTCTTGGCGCGCCAAGTGGAGGCTATACCCAGTCCTTCGC CCACCGGATATCCGGAGGCGGGCATCACCCCGAGTGTTCCCTTCGATTTA CCCAGTTCGACTGTCAAGCCGGAGAACACTTATCTGCCGCCTGATAACAC CTATGGACCTCCGGACAACACATACGGGCCACCAGATAACACTTATGGAC CTCCAGAGACCGACTCCGTGCCGGCTATTGCTCCCGAGGCTGAGCCGCTA CCAGAGAATCCCATCGAGACTGATGATATTCCAGAGACTGAGGAAGCATC GGTTGACGGTGCCAAGCTGCAGCCCGCTGATGAGGACGCCGAGGAGGATG AACCGCAGCTGGATGTTGCTGAGGATGGCACTGTGATCGTTGTAGCTAGC AGTCTTGACCAGCCACAGTCCGTCCAGTCCGCCCGACTCTACCAGCGATT TCCGCAAGGACGGCGTTCCCAGAGGCCCGTTCCTCAGCGTCTAATCCTGC GTCGCAGTTGGTAGACTTTAAAACTTTAGCGTAAGCAAATACGTCACTGC GTCAGACTTAAGGAAATATCATACAGGCAAAGACTCTAGAATAATTATTC TAGTGTCTTTGATACAGGGCTGGAATCTATTCTAACGATATCATGCACTC ACCGTACACAGAAAATATATTTACAAAATATTACTTACAAAATTCAATTT AAAATGAAATCCATACTGAAACTTAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14569-RA | 824 | CG14569-RA | 1..823 | 1..823 | 4115 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 21719660..21720482 | 823..1 | 4115 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 21730725..21731547 | 823..1 | 4115 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 21723825..21724647 | 823..1 | 4115 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
1360 | 3409 | 1360 1360 3409bp | 479..539 | 645..713 | 137 | 73.9 | Plus |
1360 | 3409 | 1360 1360 3409bp | 505..537 | 713..678 | 119 | 86.1 | Minus |
Dyak\HeT-A | 5691 | Dyak\HeT-A YAKHETA 5691bp | 94..151 | 766..821 | 113 | 70.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21719659..21719768 | 715..824 | 99 | == | Minus |
chr3L | 21719839..21720482 | 1..644 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 1..588 | 27..614 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 1..588 | 27..614 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 1..588 | 27..614 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 1..588 | 27..614 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 1..588 | 27..614 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 1..823 | 1..824 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 1..823 | 1..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 4..826 | 1..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 1..823 | 1..824 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14569-RA | 4..826 | 1..823 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21730724..21731547 | 1..824 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21730724..21731547 | 1..824 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21730724..21731547 | 1..824 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21723824..21724647 | 1..824 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21723824..21724647 | 1..824 | 99 | Minus |
Translation from 2 to 613
> RE65906.hyp NRSPSTAKMFKPTGAPIAILVLSLLALSSAEPIRRRFLARQVEAIPSPSP TGYPEAGITPSVPFDLPSSTVKPENTYLPPDNTYGPPDNTYGPPDNTYGP PETDSVPAIAPEAEPLPENPIETDDIPETEEASVDGAKLQPADEDAEEDE PQLDVAEDGTVIVVASSLDQPQSVQSARLYQRFPQGRRSQRPVPQRLILR RSW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14569-PA | 195 | CG14569-PA | 1..195 | 9..203 | 1017 | 100 | Plus |
CG14568-PA | 171 | CG14568-PA | 10..139 | 19..122 | 217 | 42.5 | Plus |
CG14570-PA | 228 | CG14570-PA | 5..127 | 12..119 | 183 | 36.1 | Plus |
Translation from 26 to 613
> RE65906.pep MFKPTGAPIAILVLSLLALSSAEPIRRRFLARQVEAIPSPSPTGYPEAGI TPSVPFDLPSSTVKPENTYLPPDNTYGPPDNTYGPPDNTYGPPETDSVPA IAPEAEPLPENPIETDDIPETEEASVDGAKLQPADEDAEEDEPQLDVAED GTVIVVASSLDQPQSVQSARLYQRFPQGRRSQRPVPQRLILRRSW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24640-PA | 186 | GF24640-PA | 7..186 | 10..195 | 592 | 69.8 | Plus |
Dana\GF24639-PA | 179 | GF24639-PA | 10..147 | 11..114 | 192 | 43.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13206-PA | 195 | GG13206-PA | 1..195 | 1..195 | 834 | 91.8 | Plus |
Dere\GG13205-PA | 171 | GG13205-PA | 10..124 | 11..98 | 206 | 47.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15095-PA | 174 | GH15095-PA | 7..170 | 10..190 | 395 | 54.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14569-PA | 195 | CG14569-PA | 1..195 | 1..195 | 1017 | 100 | Plus |
CG14568-PA | 171 | CG14568-PA | 10..139 | 11..114 | 217 | 42.5 | Plus |
CG14570-PA | 228 | CG14570-PA | 5..127 | 4..111 | 183 | 36.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13744-PA | 188 | GI13744-PA | 8..188 | 11..195 | 497 | 61.6 | Plus |
Dmoj\GI13743-PA | 209 | GI13743-PA | 89..144 | 49..93 | 157 | 62.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25275-PA | 196 | GL25275-PA | 1..196 | 1..195 | 661 | 70.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13088-PA | 196 | GA13088-PA | 1..196 | 1..195 | 660 | 70.2 | Plus |
Dpse\GA13087-PA | 181 | GA13087-PA | 7..121 | 9..91 | 163 | 46.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22115-PA | 195 | GM22115-PA | 1..195 | 1..195 | 945 | 96.9 | Plus |
Dsec\GM22114-PA | 171 | GM22114-PA | 10..139 | 11..114 | 192 | 43.5 | Plus |
Dsec\GM22116-PA | 228 | GM22116-PA | 5..113 | 4..94 | 143 | 37.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12092-PA | 195 | GD12092-PA | 1..195 | 1..195 | 938 | 96.4 | Plus |
Dsim\GD12091-PA | 171 | GD12091-PA | 10..109 | 11..93 | 175 | 45.2 | Plus |
Dsim\GD12093-PA | 228 | GD12093-PA | 37..113 | 28..94 | 139 | 45.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14090-PA | 189 | GJ14090-PA | 7..189 | 10..195 | 521 | 60.2 | Plus |
Dvir\GJ14091-PA | 261 | GJ14091-PA | 40..141 | 45..133 | 155 | 41 | Plus |
Dvir\GJ14088-PA | 177 | GJ14088-PA | 3..98 | 2..93 | 137 | 37.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17126-PA | 185 | GK17126-PA | 5..185 | 9..195 | 370 | 55 | Plus |
Dwil\GK17127-PA | 230 | GK17127-PA | 35..93 | 45..98 | 164 | 59.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22300-PA | 195 | GE22300-PA | 1..195 | 1..195 | 821 | 91.3 | Plus |
Dyak\GE22986-PA | 195 | GE22986-PA | 1..195 | 1..195 | 814 | 90.8 | Plus |
Dyak\GE22985-PA | 171 | GE22985-PA | 10..109 | 11..93 | 172 | 44.2 | Plus |
Dyak\GE22299-PA | 171 | GE22299-PA | 10..109 | 11..93 | 172 | 44.2 | Plus |
Dyak\GE22987-PA | 220 | GE22987-PA | 11..127 | 5..111 | 139 | 38.6 | Plus |