Clone RE65906 Report

Search the DGRC for RE65906

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:659
Well:6
Vector:pFlc-1
Associated Gene/TranscriptCG14569-RA
Protein status:RE65906.pep: gold
Preliminary Size:588
Sequenced Size:839

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14569 2001-12-14 Blastp of sequenced clone
CG14569 2002-01-01 Sim4 clustering to Release 2
CG14569 2003-01-01 Sim4 clustering to Release 3
CG14569 2008-04-29 Release 5.5 accounting
CG14569 2008-08-15 Release 5.9 accounting
CG14569 2008-12-18 5.12 accounting

Clone Sequence Records

RE65906.complete Sequence

839 bp (839 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071610

> RE65906.complete
AGAACAGAAGCCCTTCAACCGCGAAAATGTTTAAACCGACTGGCGCACCA
ATTGCTATTCTTGTCCTGAGCCTGTTGGCGCTGAGCTCCGCGGAGCCGAT
CCGCCGGAGGTTCTTGGCGCGCCAAGTGGAGGCTATACCCAGTCCTTCGC
CCACCGGATATCCGGAGGCGGGCATCACCCCGAGTGTTCCCTTCGATTTA
CCCAGTTCGACTGTCAAGCCGGAGAACACTTATCTGCCGCCTGATAACAC
CTATGGACCTCCGGACAACACATACGGGCCACCAGATAACACTTATGGAC
CTCCAGAGACCGACTCCGTGCCGGCTATTGCTCCCGAGGCTGAGCCGCTA
CCAGAGAATCCCATCGAGACTGATGATATTCCAGAGACTGAGGAAGCATC
GGTTGACGGTGCCAAGCTGCAGCCCGCTGATGAGGACGCCGAGGAGGATG
AACCGCAGCTGGATGTTGCTGAGGATGGCACTGTGATCGTTGTAGCTAGC
AGTCTTGACCAGCCACAGTCCGTCCAGTCCGCCCGACTCTACCAGCGATT
TCCGCAAGGACGGCGTTCCCAGAGGCCCGTTCCTCAGCGTCTAATCCTGC
GTCGCAGTTGGTAGACTTTAAAACTTTAGCGTAAGCAAATACGTCACTGC
GTCAGACTTAAGGAAATATCATACAGGCAAAGACTCTAGAATAATTATTC
TAGTGTCTTTGATACAGGGCTGGAATCTATTCTAACGATATCATGCACTC
ACCGTACACAGAAAATATATTTACAAAATATTACTTACAAAATTCAATTT
AAAATGAAATCCATACTGAAACTTAAAAAAAAAAAAAAA

RE65906.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14569-RA 824 CG14569-RA 1..823 1..823 4115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21719660..21720482 823..1 4115 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21730725..21731547 823..1 4115 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21723825..21724647 823..1 4115 100 Minus
Blast to na_te.dros performed 2019-03-16 23:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 479..539 645..713 137 73.9 Plus
1360 3409 1360 1360 3409bp 505..537 713..678 119 86.1 Minus
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 94..151 766..821 113 70.7 Plus

RE65906.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:35:15 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21719659..21719768 715..824 99 == Minus
chr3L 21719839..21720482 1..644 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:31:39 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 1..588 27..614 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:20 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 1..588 27..614 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:21:18 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 1..588 27..614 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:34 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 1..588 27..614 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:51:52 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 1..588 27..614 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:38:43 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 1..823 1..824 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:20 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 1..823 1..823 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:21:18 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 4..826 1..823 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:35 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 1..823 1..824 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:51:52 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
CG14569-RA 4..826 1..823 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:15 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21730724..21731547 1..824 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:15 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21730724..21731547 1..824 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:15 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21730724..21731547 1..824 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:21:18 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21723824..21724647 1..824 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:39 Download gff for RE65906.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21723824..21724647 1..824 99   Minus

RE65906.hyp Sequence

Translation from 2 to 613

> RE65906.hyp
NRSPSTAKMFKPTGAPIAILVLSLLALSSAEPIRRRFLARQVEAIPSPSP
TGYPEAGITPSVPFDLPSSTVKPENTYLPPDNTYGPPDNTYGPPDNTYGP
PETDSVPAIAPEAEPLPENPIETDDIPETEEASVDGAKLQPADEDAEEDE
PQLDVAEDGTVIVVASSLDQPQSVQSARLYQRFPQGRRSQRPVPQRLILR
RSW*

RE65906.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG14569-PA 195 CG14569-PA 1..195 9..203 1017 100 Plus
CG14568-PA 171 CG14568-PA 10..139 19..122 217 42.5 Plus
CG14570-PA 228 CG14570-PA 5..127 12..119 183 36.1 Plus

RE65906.pep Sequence

Translation from 26 to 613

> RE65906.pep
MFKPTGAPIAILVLSLLALSSAEPIRRRFLARQVEAIPSPSPTGYPEAGI
TPSVPFDLPSSTVKPENTYLPPDNTYGPPDNTYGPPDNTYGPPETDSVPA
IAPEAEPLPENPIETDDIPETEEASVDGAKLQPADEDAEEDEPQLDVAED
GTVIVVASSLDQPQSVQSARLYQRFPQGRRSQRPVPQRLILRRSW*

RE65906.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24640-PA 186 GF24640-PA 7..186 10..195 592 69.8 Plus
Dana\GF24639-PA 179 GF24639-PA 10..147 11..114 192 43.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13206-PA 195 GG13206-PA 1..195 1..195 834 91.8 Plus
Dere\GG13205-PA 171 GG13205-PA 10..124 11..98 206 47.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15095-PA 174 GH15095-PA 7..170 10..190 395 54.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG14569-PA 195 CG14569-PA 1..195 1..195 1017 100 Plus
CG14568-PA 171 CG14568-PA 10..139 11..114 217 42.5 Plus
CG14570-PA 228 CG14570-PA 5..127 4..111 183 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13744-PA 188 GI13744-PA 8..188 11..195 497 61.6 Plus
Dmoj\GI13743-PA 209 GI13743-PA 89..144 49..93 157 62.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25275-PA 196 GL25275-PA 1..196 1..195 661 70.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13088-PA 196 GA13088-PA 1..196 1..195 660 70.2 Plus
Dpse\GA13087-PA 181 GA13087-PA 7..121 9..91 163 46.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22115-PA 195 GM22115-PA 1..195 1..195 945 96.9 Plus
Dsec\GM22114-PA 171 GM22114-PA 10..139 11..114 192 43.5 Plus
Dsec\GM22116-PA 228 GM22116-PA 5..113 4..94 143 37.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12092-PA 195 GD12092-PA 1..195 1..195 938 96.4 Plus
Dsim\GD12091-PA 171 GD12091-PA 10..109 11..93 175 45.2 Plus
Dsim\GD12093-PA 228 GD12093-PA 37..113 28..94 139 45.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14090-PA 189 GJ14090-PA 7..189 10..195 521 60.2 Plus
Dvir\GJ14091-PA 261 GJ14091-PA 40..141 45..133 155 41 Plus
Dvir\GJ14088-PA 177 GJ14088-PA 3..98 2..93 137 37.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17126-PA 185 GK17126-PA 5..185 9..195 370 55 Plus
Dwil\GK17127-PA 230 GK17127-PA 35..93 45..98 164 59.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22300-PA 195 GE22300-PA 1..195 1..195 821 91.3 Plus
Dyak\GE22986-PA 195 GE22986-PA 1..195 1..195 814 90.8 Plus
Dyak\GE22985-PA 171 GE22985-PA 10..109 11..93 172 44.2 Plus
Dyak\GE22299-PA 171 GE22299-PA 10..109 11..93 172 44.2 Plus
Dyak\GE22987-PA 220 GE22987-PA 11..127 5..111 139 38.6 Plus