Clone RE66104 Report

Search the DGRC for RE66104

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:661
Well:4
Vector:pFlc-1
Associated Gene/TranscriptNca-RA
Protein status:RE66104.pep: gold
Sequenced Size:879

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7641 2001-12-14 Blastp of sequenced clone
CG7641 2002-01-01 Sim4 clustering to Release 2
CG7646 2002-01-01 Sim4 clustering to Release 2
Nca 2008-04-29 Release 5.5 accounting
Nca 2008-08-15 Release 5.9 accounting
CG7646 2008-08-15 Release 5.9 accounting
Nca 2008-12-18 5.12 accounting
CG7646 2008-12-18 5.12 accounting

Clone Sequence Records

RE66104.complete Sequence

879 bp (879 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071612

> RE66104.complete
AAATTTGTTGTATTGATTGTGTTTTGGTCGAATAAGTTTATTGCATTTGC
GAAAAGTGATTTTGTTTAGCCTAGCGGGTAGCAGAAATGTGCCTAAAATC
AATGTGTCATTTTCGTTCAGCATATTAGCCTCAGTAGGTAAATAATGCTT
TGACTTGGTCGACGGAAATCAAACTGATATAACTGTATAATGAAATTGTT
CTGCAACAATGGGAAAGCAAAATAGTAAACTAAAACCAGAAGTTTTGGAG
GATCTCAAGCAAAACACAGAGTTCACAGACGCTGAGATTCAAGAATGGTA
TAAAGGCTTTCTTAAGGACTGCCCTAGTGGGCATTTATCAGTAGAAGAGT
TTAAAAAGATTTATGGGAACTTTTTCCCATATGGTGACGCTAGCAAGTTT
GCAGAGCATGTCTTCCGGACATTCGACGCCAACGGCGATGGCACTATAGA
CTTTAGAGAGTTCTTGTGTGCACTAAGTGTCACATCGCGGGGCAAACTCG
AGCAGAAACTCAAATGGGCATTCTCAATGTACGATCTTGATGGGAACGGA
TACATATCGCGGCAGGAAATGCTAGAAATTGTTACAGCAATATATAAAAT
GGTCGGCTCGGTGATGAAAATGCCAGAGGACGAGAGTACTCCTGAGAAAC
GAACCGACAAGATTTTTCGTCAAATGGATCGAAACAAGGATGGGAAATTA
AGCTTGGAAGAGTTCATAGAAGGAGCCAAAAGTGATCCATCAATAGTACG
ATTATTACAGTGTGATCCACAGTCTCATTAACTTAATTACTATTGAAAAG
CAAGCAATAATCATTTAAACGTGTATAGAGTAATTGCGAATTAAATTGTT
TTGTTTCAGTATGAAAAAAAAAAAAAAAA

RE66104.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Nca-RB 993 Nca-RB 1..863 1..863 4315 100 Plus
Nca-RA 863 Nca-RA 1..863 1..863 4315 100 Plus
CG7646-RB 598 CG7646-RB 8..185 1..178 890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19986607..19986883 587..863 1385 100 Plus
chr3L 24539361 chr3L 19986344..19986535 396..587 960 100 Plus
chr3L 24539361 chr3L 19986163..19986283 277..397 605 100 Plus
chr3L 24539361 chr3L 19981241..19981360 1..120 600 100 Plus
chr3L 24539361 chr3L 19985996..19986095 179..278 500 100 Plus
chr3L 24539361 chr3L 19982575..19982641 116..182 320 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19997292..19997568 587..863 1385 100 Plus
3L 28110227 3L 19997029..19997220 396..587 960 100 Plus
3L 28110227 3L 19996848..19996968 277..397 605 100 Plus
3L 28110227 3L 19991923..19992042 1..120 600 100 Plus
3L 28110227 3L 19996681..19996780 179..278 500 100 Plus
3L 28110227 3L 19993260..19993326 116..182 320 98.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19990392..19990668 587..863 1385 100 Plus
3L 28103327 3L 19990129..19990320 396..587 960 100 Plus
3L 28103327 3L 19989948..19990068 277..397 605 100 Plus
3L 28103327 3L 19985023..19985142 1..120 600 100 Plus
3L 28103327 3L 19989781..19989880 179..278 500 100 Plus
3L 28103327 3L 19986360..19986426 116..182 320 98.5 Plus
Blast to na_te.dros performed on 2019-03-16 12:51:05 has no hits.

RE66104.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:51:43 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19981241..19981360 1..120 100 -> Plus
chr3L 19982580..19982637 121..178 100 -> Plus
chr3L 19985996..19986095 179..278 100 -> Plus
chr3L 19986165..19986283 279..397 100 -> Plus
chr3L 19986346..19986534 398..586 100 -> Plus
chr3L 19986607..19986883 587..863 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:31:42 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RA 1..573 209..781 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:56 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RB 1..573 209..781 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:18 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RA 1..573 209..781 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:36 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RA 1..573 209..781 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:09:52 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RA 1..573 209..781 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:40 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:56 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RB 1..863 1..863 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:18 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RA 37..899 1..863 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:36 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RA 1..858 1..858 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:09:52 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
Nca-RA 37..899 1..863 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:43 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19991923..19992042 1..120 100 -> Plus
3L 19993265..19993322 121..178 100 -> Plus
3L 19996681..19996780 179..278 100 -> Plus
3L 19996850..19996968 279..397 100 -> Plus
3L 19997031..19997219 398..586 100 -> Plus
3L 19997292..19997568 587..863 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:43 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19991923..19992042 1..120 100 -> Plus
3L 19993265..19993322 121..178 100 -> Plus
3L 19996681..19996780 179..278 100 -> Plus
3L 19996850..19996968 279..397 100 -> Plus
3L 19997031..19997219 398..586 100 -> Plus
3L 19997292..19997568 587..863 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:43 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19991923..19992042 1..120 100 -> Plus
3L 19993265..19993322 121..178 100 -> Plus
3L 19996681..19996780 179..278 100 -> Plus
3L 19996850..19996968 279..397 100 -> Plus
3L 19997031..19997219 398..586 100 -> Plus
3L 19997292..19997568 587..863 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:18 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19990392..19990668 587..863 100   Plus
arm_3L 19985023..19985142 1..120 100 -> Plus
arm_3L 19986365..19986422 121..178 100 -> Plus
arm_3L 19989781..19989880 179..278 100 -> Plus
arm_3L 19989950..19990068 279..397 100 -> Plus
arm_3L 19990131..19990319 398..586 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:59:56 Download gff for RE66104.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19990392..19990668 587..863 100   Plus
3L 19985023..19985142 1..120 100 -> Plus
3L 19986365..19986422 121..178 100 -> Plus
3L 19989781..19989880 179..278 100 -> Plus
3L 19989950..19990068 279..397 100 -> Plus
3L 19990131..19990319 398..586 100 -> Plus

RE66104.hyp Sequence

Translation from 208 to 780

> RE66104.hyp
MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKK
IYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQK
LKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTD
KIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQSH*

RE66104.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Nca-PA 190 CG7641-PA 1..190 1..190 1002 100 Plus
Frq1-PE 187 CG5744-PE 1..182 1..183 582 60.1 Plus
Frq1-PD 187 CG5744-PD 1..182 1..183 582 60.1 Plus
Frq1-PC 187 CG5744-PC 1..182 1..183 582 60.1 Plus
Frq1-PB 187 CG5744-PB 1..182 1..183 582 60.1 Plus

RE66104.pep Sequence

Translation from 208 to 780

> RE66104.pep
MGKQNSKLKPEVLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKK
IYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFLCALSVTSRGKLEQK
LKWAFSMYDLDGNGYISRQEMLEIVTAIYKMVGSVMKMPEDESTPEKRTD
KIFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLLQCDPQSH*

RE66104.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23611-PA 233 GF23611-PA 1..175 1..175 929 99.4 Plus
Dana\GF22427-PA 187 GF22427-PA 1..182 1..183 584 60.1 Plus
Dana\GF22428-PA 187 GF22428-PA 1..182 1..183 578 59.6 Plus
Dana\GF23610-PA 186 GF23610-PA 1..184 1..183 452 49.5 Plus
Dana\GF16777-PA 206 GF16777-PA 26..200 10..184 423 42.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16076-PA 190 GG16076-PA 1..190 1..190 1018 100 Plus
Dere\GG19154-PA 187 GG19154-PA 1..182 1..183 578 59.6 Plus
Dere\GG19152-PA 220 GG19152-PA 50..215 18..183 540 61.7 Plus
Dere\GG16075-PA 186 GG16075-PA 1..184 1..183 452 49.5 Plus
Dere\GG11429-PA 206 GG11429-PA 26..200 10..184 423 42.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14390-PA 190 GH14390-PA 1..190 1..190 1011 98.9 Plus
Dgri\GH17717-PA 187 GH17717-PA 1..182 1..183 584 60.1 Plus
Dgri\GH17718-PA 187 GH17718-PA 1..182 1..183 578 59.6 Plus
Dgri\GH14389-PA 186 GH14389-PA 1..184 1..183 452 49.5 Plus
Dgri\GH22305-PA 206 GH22305-PA 26..200 10..184 424 43.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Nca-PA 190 CG7641-PA 1..190 1..190 1002 100 Plus
Frq1-PE 187 CG5744-PE 1..182 1..183 582 60.1 Plus
Frq1-PD 187 CG5744-PD 1..182 1..183 582 60.1 Plus
Frq1-PC 187 CG5744-PC 1..182 1..183 582 60.1 Plus
Frq1-PB 187 CG5744-PB 1..182 1..183 582 60.1 Plus
Frq2-PD 187 CG5907-PD 1..182 1..183 574 59.6 Plus
Frq2-PC 187 CG5907-PC 1..182 1..183 574 59.6 Plus
Frq2-PB 187 CG5907-PB 1..182 1..183 574 59.6 Plus
Frq2-PA 187 CG5907-PA 1..182 1..183 574 59.6 Plus
CG7646-PC 186 CG7646-PC 1..184 1..183 451 49.5 Plus
CG7646-PA 186 CG7646-PA 1..184 1..183 451 49.5 Plus
CG5890-PD 206 CG5890-PD 26..200 10..184 413 42.9 Plus
CG5890-PC 206 CG5890-PC 26..200 10..184 413 42.9 Plus
CG5890-PA 206 CG5890-PA 26..200 10..184 413 42.9 Plus
CG44422-PE 363 CG44422-PE 178..354 6..181 401 40.7 Plus
CG44422-PB 436 CG44422-PB 251..427 6..181 401 40.7 Plus
CG44422-PC 450 CG44422-PC 265..441 6..181 401 40.7 Plus
CG44422-PF 673 CG44422-PF 178..354 6..181 401 40.7 Plus
CG44422-PA 746 CG44422-PA 251..427 6..181 401 40.7 Plus
CG44422-PD 439 CG44422-PD 251..430 6..181 398 40 Plus
CanB-PB 170 CG4209-PB 35..153 40..169 187 35.1 Plus
CanB-PA 170 CG4209-PA 35..153 40..169 187 35.1 Plus
CanB2-PB 170 CG11217-PB 35..153 40..169 186 35.1 Plus
CanB2-PA 170 CG11217-PA 35..153 40..169 186 35.1 Plus
CG7646-PB 78 CG7646-PB 1..76 107..183 163 44.9 Plus
CG2256-PC 324 CG2256-PC 101..310 1..187 162 24.1 Plus
Nox-PB 1282 CG34399-PB 350..462 46..167 157 31.1 Plus
Nox-PE 1340 CG34399-PE 350..462 46..167 157 31.1 Plus
Nox-PD 1340 CG34399-PD 350..462 46..167 157 31.1 Plus
Nox-PC 1340 CG34399-PC 350..462 46..167 157 31.1 Plus
elm-PB 189 CG2185-PB 1..170 1..169 155 31.5 Plus
elm-PA 189 CG2185-PA 1..170 1..169 155 31.5 Plus
Cam-PD 149 CG8472-PD 4..143 18..170 150 27.9 Plus
Cam-PC 149 CG8472-PC 4..143 18..170 150 27.9 Plus
Cam-PE 149 CG8472-PE 4..143 18..170 150 27.9 Plus
Cam-PB 149 CG8472-PB 4..143 18..170 150 27.9 Plus
Cam-PA 149 CG8472-PA 4..143 18..170 150 27.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11334-PA 190 GI11334-PA 1..190 1..190 1011 98.9 Plus
Dmoj\GI15466-PA 187 GI15466-PA 1..182 1..183 578 59.6 Plus
Dmoj\GI15464-PA 188 GI15464-PA 1..183 1..183 508 54.9 Plus
Dmoj\GI11333-PA 186 GI11333-PA 1..184 1..183 452 49.5 Plus
Dmoj\GI22974-PA 206 GI22974-PA 26..200 10..184 426 43.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11894-PA 190 GL11894-PA 1..190 1..190 1018 100 Plus
Dper\GL26964-PA 187 GL26964-PA 1..182 1..183 584 60.1 Plus
Dper\GL26965-PA 187 GL26965-PA 1..182 1..183 578 59.6 Plus
Dper\GL11893-PA 186 GL11893-PA 1..184 1..183 452 49.5 Plus
Dper\GL21539-PA 206 GL21539-PA 26..200 10..184 423 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19219-PA 187 GA19219-PA 1..182 1..183 578 59.6 Plus
Dpse\GA19207-PA 206 GA19207-PA 26..200 10..184 423 42.9 Plus
Dpse\GA10762-PA 195 GA10762-PA 10..190 6..185 402 39.8 Plus
Dpse\GA22326-PA 101 GA22326-PA 1..76 1..76 228 56.6 Plus
Dpse\GA18033-PA 170 GA18033-PA 35..153 40..169 187 34.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19732-PA 190 GM19732-PA 1..190 1..190 1018 100 Plus
Dsec\GM22886-PA 187 GM22886-PA 1..182 1..183 578 59.6 Plus
Dsec\GM19731-PA 186 GM19731-PA 1..184 1..183 452 49.5 Plus
Dsec\GM10270-PA 206 GM10270-PA 26..200 10..184 423 42.9 Plus
Dsec\GM22884-PA 106 GM22884-PA 22..101 103..183 271 63 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14847-PA 190 GD14847-PA 1..190 1..190 1018 100 Plus
Dsim\GD24850-PA 187 GD24850-PA 1..185 1..186 585 59.1 Plus
Dsim\GD24687-PA 197 GD24687-PA 1..182 1..183 578 59.6 Plus
Dsim\GD14846-PA 186 GD14846-PA 1..184 1..183 452 49.5 Plus
Dsim\GD21239-PA 206 GD21239-PA 26..200 10..184 423 42.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11590-PA 190 GJ11590-PA 1..190 1..190 1008 98.4 Plus
Dvir\GJ19176-PA 187 GJ19176-PA 1..182 1..183 578 59.6 Plus
Dvir\GJ11589-PA 186 GJ11589-PA 1..184 1..183 452 49.5 Plus
Dvir\GJ19175-PA 148 GJ19175-PA 1..136 1..136 427 57.4 Plus
Dvir\GJ22734-PA 206 GJ22734-PA 26..200 10..184 420 42.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20284-PA 190 GK20284-PA 1..190 1..190 1015 99.5 Plus
Dwil\GK19999-PA 187 GK19999-PA 1..182 1..183 584 60.1 Plus
Dwil\GK20001-PA 251 GK20001-PA 65..246 1..183 579 59.6 Plus
Dwil\GK20281-PA 186 GK20281-PA 1..184 1..183 452 49.5 Plus
Dwil\GK12862-PA 206 GK12862-PA 26..200 10..184 424 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19642-PA 190 GE19642-PA 1..190 1..190 1018 100 Plus
Dyak\GE23224-PA 190 GE23224-PA 1..190 1..190 1018 100 Plus
Dyak\GE17711-PA 187 GE17711-PA 1..182 1..183 584 60.1 Plus
Dyak\GE17713-PA 187 GE17713-PA 1..182 1..183 578 59.6 Plus
Dyak\GE19641-PA 186 GE19641-PA 1..184 1..183 452 49.5 Plus