Clone RE66244 Report

Search the DGRC for RE66244

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:662
Well:44
Vector:pFlc-1
Associated Gene/Transcriptmex1-RA
Protein status:RE66244.pep: gold
Preliminary Size:530
Sequenced Size:722

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7936 2001-12-14 Blastp of sequenced clone
CG7936 2002-01-01 Sim4 clustering to Release 2
CG7936 2003-01-01 Sim4 clustering to Release 3
mex1 2008-04-29 Release 5.5 accounting
mex1 2008-08-15 Release 5.9 accounting
mex1 2008-12-18 5.12 accounting

Clone Sequence Records

RE66244.complete Sequence

722 bp (722 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071615

> RE66244.complete
GGTTAATATTTTGTGTTGGTCAACCACGCATCGGGAATCGGAAATATACT
GTACAGTATATCTATCTATAATAGAATAACCCAAAAAAGTCATCACCATG
TGCAACGCTCTCTGTGAATGCCTCAAATGTCCCGGCAAAGTGGTTTGCTG
CTGCTGTTCCTGCGCCTGCAAGATGCTCCTGAGCATCGTGTTTTCTGCGC
TCCTGATGGTCGTGGTGATCGGCTTGATTGTCTACTTCACGGTCTTCTAT
CACAAGGATAAGAACACGGATGAGGTGCAGAAGCAGGTCGCCCAACTGAC
GCCCATTGTGAAGCGCAGCATACGCGACTACTTCAACAAGGAGTACTGAT
CTGAGGACATGAATTTATACTATAGGCCATATTAATAATAACTCCGTCGA
AATCGAAATTGAAACGAACTAAGAACCAAAGCCGTTCAGTGCATGACTTA
ATCTAATCGCGTCGGATGCTCGTTATGGGATTTTTTCTTATCTATAGATA
GTTTGGGACTCAATTGAATGGGCAATTTGTGCGTTCTTTAGAAAGGTAGA
TAATGTTGGAGCGGCAAAAAATGTGACTCACTGTATACCTTACAATACAT
TTTGAACTCGAAACCCAGTAAAGCATTCACAATATATATTTAATGTATAA
TATGTATGAATGTAAGGCAGATTAAAAAAGTTATATTGTACTGGATGACA
CACTATAAAAAAAAAAAAAAAA

RE66244.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
mex1.a 1205 mex1.a 330..1050 2..722 3545 99.4 Plus
mex1-RA 939 mex1-RA 64..784 2..722 3545 99.4 Plus
nc_12719.a 737 nc_12719.a 78..708 92..722 2975 98 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15507416..15507977 706..145 2780 99.6 Minus
chr3L 24539361 chr3L 15508246..15508394 150..2 745 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15517457..15518034 722..145 2815 99.1 Minus
3L 28110227 3L 15518308..15518456 150..2 745 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15510557..15511134 722..145 2815 99.1 Minus
3L 28103327 3L 15511408..15511556 150..2 745 100 Minus
3L 28103327 3L 15512557..15512615 150..92 175 86.4 Minus
Blast to na_te.dros performed 2019-03-16 03:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6820 219..145 111 62.7 Minus

RE66244.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:05:16 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15507416..15507971 151..706 99 <- Minus
chr3L 15508246..15508394 1..150 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:31:51 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..252 98..349 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:38 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..252 98..349 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:26:05 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..252 98..349 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:38:08 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..252 98..349 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:30:05 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..252 98..349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:55 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..705 2..706 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:37 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..705 2..706 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:26:05 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 5..710 1..706 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:38:08 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..705 2..706 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:30:05 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 5..710 1..706 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:16 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15517473..15518028 151..706 100 <- Minus
3L 15518308..15518456 1..150 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:16 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15517473..15518028 151..706 100 <- Minus
3L 15518308..15518456 1..150 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:16 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15517473..15518028 151..706 100 <- Minus
3L 15518308..15518456 1..150 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:26:05 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15510573..15511128 151..706 100 <- Minus
arm_3L 15511408..15511556 1..150 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:27 Download gff for RE66244.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15510573..15511128 151..706 100 <- Minus
3L 15511408..15511556 1..150 99   Minus

RE66244.pep Sequence

Translation from 97 to 348

> RE66244.pep
MCNALCECLKCPGKVVCCCCSCACKMLLSIVFSALLMVVVIGLIVYFTVF
YHKDKNTDEVQKQVAQLTPIVKRSIRDYFNKEY*

RE66244.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10729-PA 83 GF10729-PA 1..83 1..83 350 90.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13544-PA 83 GG13544-PA 1..83 1..83 416 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23377-PA 82 GH23377-PA 1..82 1..83 275 73.5 Plus
Dgri\GH17020-PA 82 GH17020-PA 1..82 1..83 275 73.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-PC 83 CG7936-PC 1..83 1..83 450 100 Plus
mex1-PA 83 CG7936-PA 1..83 1..83 450 100 Plus
mex1-PB 83 CG7936-PB 1..83 1..83 447 97.6 Plus
CG42394-PC 77 CG42394-PC 1..75 5..81 149 36.4 Plus
CG42394-PB 77 CG42394-PB 1..75 5..81 149 36.4 Plus
CG42394-PD 77 CG42394-PD 1..75 5..81 149 36.4 Plus
CG42394-PA 77 CG42394-PA 1..75 5..81 149 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12225-PA 82 GI12225-PA 1..82 1..83 314 72.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20701-PA 83 GA20701-PA 1..83 1..83 274 85.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24487-PA 83 GM24487-PA 1..83 1..83 425 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12559-PA 83 GD12559-PA 1..83 1..83 425 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11455-PA 82 GJ11455-PA 1..81 1..82 264 73.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10522-PA 81 GK10522-PA 1..81 1..83 226 66.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22845-PA 83 GE22845-PA 1..83 1..83 416 97.6 Plus
Dyak\GE19847-PA 83 GE19847-PA 1..83 1..83 412 96.4 Plus

RE66244.hyp Sequence

Translation from 97 to 348

> RE66244.hyp
MCNALCECLKCPGKVVCCCCSCACKMLLSIVFSALLMVVVIGLIVYFTVF
YHKDKNTDEVQKQVAQLTPIVKRSIRDYFNKEY*

RE66244.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-PC 83 CG7936-PC 1..83 1..83 450 100 Plus
mex1-PA 83 CG7936-PA 1..83 1..83 450 100 Plus
mex1-PB 83 CG7936-PB 1..83 1..83 447 97.6 Plus
CG42394-PC 77 CG42394-PC 1..75 5..81 149 36.4 Plus
CG42394-PB 77 CG42394-PB 1..75 5..81 149 36.4 Plus