BDGP Sequence Production Resources |
Search the DGRC for RE66462
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 664 |
Well: | 62 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG32441-RC |
Protein status: | RE66462.pep: gold |
Sequenced Size: | 901 |
Gene | Date | Evidence |
---|---|---|
CG32441 | 2003-01-01 | Sim4 clustering to Release 3 |
CG32441 | 2004-07-15 | Blastp of sequenced clone |
CG32441 | 2008-04-29 | Release 5.5 accounting |
CG32441 | 2008-08-15 | Release 5.9 accounting |
CG32441 | 2008-12-18 | 5.12 accounting |
901 bp (901 high quality bases) assembled on 2004-07-15
GenBank Submission: BT015204
> RE66462.complete GTCACTCTATTGGCAACCCTCAGACGATTGAAAAATTAAAATTAAAATTG AGCGTTTGGCAGGGAAATATGTATTCAAAGGCGGGATTTGTTCTAATTTT CGTGCTGGGTCTAGTGTCCAGCAGCTGGGGATTCCTGGAGCATGACAGCT GGATTACAGTGGAGCTCCAGCACTCGCTGGCTGCAAACTCGGAAAGTTTC TCCTTCCGCGGGAATGTGACGATTCCCAGTCTCAACTCTGGTCTGGCCAA TGTGGAGCAACCAGATCTGAGCACTGCCGATCTGGACTTGCTGAAGAAAC TGGCCCTTGGAAACGAGTTCTACCGTTTGAAGGCCACGGTGGTGTATTCA AATGGAGCTAAGGCGCAGTTCATCACTTCCAACAAGGCCTGTCGCCTGCT GCAAGCCCAATTGAATGACGTGCTTTGGGTGTCGCTCGAACCCTCCGGAT ACGTAACCGGCATCACTGTGTCCCAGGACACGGCCCCGGCCACTATAGAG TGCACCCAGGAAGACGTGAATAAGCTACTGGAAACGCAATTCAGCACCGA TGTCCTCATCCGCCACGCTGAACTGGCCCCCGTGCCCGATACTGCTGGCT TTATTCAGAAGGTGGAGCGGGAGCGCGAGGCCAGGGAGCGCGGGGAGGTT CGGGATAACCGCGGCTTCTTTGCCAAATACTGGATGTACATCGTTCCGGT AGTTCTGTTGGTCTTCATTTCGGGAGCCACCAACCAGGACGGTGCAAAAT AGGTTAACTGAGTGATGTGGTGTAATCTTTTGTTTGTTAGCTTTTTCTAA TCACAATTCCTAGACAACTTTGGTTTTAGCGATTAAAGATTGAGTAAAAT AAAAATGATTGAGACATTTTAAATTAAATATACACAAAAAAAAAAAAAAA A
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 21564161..21564546 | 295..680 | 1915 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 21564606..21564810 | 681..885 | 1025 | 100 | Plus |
chr3L | 24539361 | chr3L | 21563679..21563847 | 128..296 | 845 | 100 | Plus |
chr3L | 24539361 | chr3L | 21563495..21563623 | 1..129 | 645 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 21575225..21575610 | 295..680 | 1930 | 100 | Plus |
3L | 28110227 | 3L | 21575670..21575879 | 681..890 | 1035 | 99.5 | Plus |
3L | 28110227 | 3L | 21574743..21574911 | 128..296 | 845 | 100 | Plus |
3L | 28110227 | 3L | 21574559..21574687 | 1..129 | 645 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 21568325..21568710 | 295..680 | 1930 | 100 | Plus |
3L | 28103327 | 3L | 21568770..21568979 | 681..890 | 1035 | 99.5 | Plus |
3L | 28103327 | 3L | 21567843..21568011 | 128..296 | 845 | 100 | Plus |
3L | 28103327 | 3L | 21567659..21567787 | 1..129 | 645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21563495..21563622 | 1..128 | 100 | -> | Plus |
chr3L | 21563680..21563847 | 129..296 | 100 | -> | Plus |
chr3L | 21564163..21564546 | 297..680 | 99 | -> | Plus |
chr3L | 21564606..21564810 | 681..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RC | 1..684 | 69..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RC | 1..684 | 69..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RC | 1..684 | 69..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RA | 1..621 | 69..690 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RC | 1..684 | 69..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RC | 1..885 | 1..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RC | 1..885 | 1..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RC | 3..887 | 1..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RA | 1..689 | 1..690 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32441-RC | 3..887 | 1..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21574559..21574686 | 1..128 | 100 | -> | Plus |
3L | 21574744..21574911 | 129..296 | 100 | -> | Plus |
3L | 21575227..21575610 | 297..680 | 100 | -> | Plus |
3L | 21575670..21575874 | 681..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21574559..21574686 | 1..128 | 100 | -> | Plus |
3L | 21574744..21574911 | 129..296 | 100 | -> | Plus |
3L | 21575227..21575610 | 297..680 | 100 | -> | Plus |
3L | 21575670..21575874 | 681..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21574559..21574686 | 1..128 | 100 | -> | Plus |
3L | 21574744..21574911 | 129..296 | 100 | -> | Plus |
3L | 21575227..21575610 | 297..680 | 100 | -> | Plus |
3L | 21575670..21575874 | 681..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21567659..21567786 | 1..128 | 100 | -> | Plus |
arm_3L | 21567844..21568011 | 129..296 | 100 | -> | Plus |
arm_3L | 21568327..21568710 | 297..680 | 100 | -> | Plus |
arm_3L | 21568770..21568974 | 681..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21568327..21568710 | 297..680 | 100 | -> | Plus |
3L | 21568770..21568974 | 681..885 | 100 | Plus | |
3L | 21567659..21567786 | 1..128 | 100 | -> | Plus |
3L | 21567844..21568011 | 129..296 | 100 | -> | Plus |
Translation from 2 to 751
> RE66462.hyp HSIGNPQTIEKLKLKLSVWQGNMYSKAGFVLIFVLGLVSSSWGFLEHDSW ITVELQHSLAANSESFSFRGNVTIPSLNSGLANVEQPDLSTADLDLLKKL ALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGY VTGITVSQDTAPATIECTQEDVNKLLETQFSTDVLIRHAELAPVPDTAGF IQKVEREREARERGEVRDNRGFFAKYWMYIVPVVLLVFISGATNQDGAK*
Translation from 2 to 751
> RE66462.pep HSIGNPQTIEKLKLKLSVWQGNMYSKAGFVLIFVLGLVSSSWGFLEHDSW ITVELQHSLAANSESFSFRGNVTIPSLNSGLANVEQPDLSTADLDLLKKL ALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGY VTGITVSQDTAPATIECTQEDVNKLLETQFSTDVLIRHAELAPVPDTAGF IQKVEREREARERGEVRDNRGFFAKYWMYIVPVVLLVFISGATNQDGAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23728-PA | 227 | GF23728-PA | 1..227 | 23..249 | 917 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16204-PA | 227 | GG16204-PA | 1..227 | 23..249 | 1008 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14182-PA | 224 | GH14182-PA | 2..224 | 28..249 | 716 | 65 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32441-PC | 227 | CG32441-PC | 1..227 | 23..249 | 1154 | 100 | Plus |
CG32441-PD | 214 | CG32441-PD | 2..214 | 37..249 | 1056 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22092-PA | 228 | GI22092-PA | 1..228 | 23..249 | 704 | 64 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18105-PA | 224 | GL18105-PA | 5..224 | 30..249 | 927 | 76.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16906-PA | 224 | GA16906-PA | 5..224 | 30..249 | 927 | 76.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22386-PA | 218 | GM22386-PA | 8..211 | 23..226 | 1065 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17649-PA | 211 | GD17649-PA | 1..204 | 23..226 | 1068 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24207-PA | 228 | GJ24207-PA | 1..228 | 23..249 | 733 | 65.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18047-PA | 227 | GK18047-PA | 1..227 | 23..249 | 818 | 72.2 | Plus |