Clone RE66462 Report

Search the DGRC for RE66462

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:664
Well:62
Vector:pFlc-1
Associated Gene/TranscriptCG32441-RC
Protein status:RE66462.pep: gold
Sequenced Size:901

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32441 2003-01-01 Sim4 clustering to Release 3
CG32441 2004-07-15 Blastp of sequenced clone
CG32441 2008-04-29 Release 5.5 accounting
CG32441 2008-08-15 Release 5.9 accounting
CG32441 2008-12-18 5.12 accounting

Clone Sequence Records

RE66462.complete Sequence

901 bp (901 high quality bases) assembled on 2004-07-15

GenBank Submission: BT015204

> RE66462.complete
GTCACTCTATTGGCAACCCTCAGACGATTGAAAAATTAAAATTAAAATTG
AGCGTTTGGCAGGGAAATATGTATTCAAAGGCGGGATTTGTTCTAATTTT
CGTGCTGGGTCTAGTGTCCAGCAGCTGGGGATTCCTGGAGCATGACAGCT
GGATTACAGTGGAGCTCCAGCACTCGCTGGCTGCAAACTCGGAAAGTTTC
TCCTTCCGCGGGAATGTGACGATTCCCAGTCTCAACTCTGGTCTGGCCAA
TGTGGAGCAACCAGATCTGAGCACTGCCGATCTGGACTTGCTGAAGAAAC
TGGCCCTTGGAAACGAGTTCTACCGTTTGAAGGCCACGGTGGTGTATTCA
AATGGAGCTAAGGCGCAGTTCATCACTTCCAACAAGGCCTGTCGCCTGCT
GCAAGCCCAATTGAATGACGTGCTTTGGGTGTCGCTCGAACCCTCCGGAT
ACGTAACCGGCATCACTGTGTCCCAGGACACGGCCCCGGCCACTATAGAG
TGCACCCAGGAAGACGTGAATAAGCTACTGGAAACGCAATTCAGCACCGA
TGTCCTCATCCGCCACGCTGAACTGGCCCCCGTGCCCGATACTGCTGGCT
TTATTCAGAAGGTGGAGCGGGAGCGCGAGGCCAGGGAGCGCGGGGAGGTT
CGGGATAACCGCGGCTTCTTTGCCAAATACTGGATGTACATCGTTCCGGT
AGTTCTGTTGGTCTTCATTTCGGGAGCCACCAACCAGGACGGTGCAAAAT
AGGTTAACTGAGTGATGTGGTGTAATCTTTTGTTTGTTAGCTTTTTCTAA
TCACAATTCCTAGACAACTTTGGTTTTAGCGATTAAAGATTGAGTAAAAT
AAAAATGATTGAGACATTTTAAATTAAATATACACAAAAAAAAAAAAAAA
A

RE66462.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG32441-RC 1186 CG32441-RC 127..1016 1..890 4435 99.8 Plus
CG32441.a 1473 CG32441.a 127..1016 1..890 4435 99.8 Plus
CG32441-RD 1077 CG32441-RD 145..907 128..890 3800 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21564161..21564546 295..680 1915 99.7 Plus
chr3L 24539361 chr3L 21564606..21564810 681..885 1025 100 Plus
chr3L 24539361 chr3L 21563679..21563847 128..296 845 100 Plus
chr3L 24539361 chr3L 21563495..21563623 1..129 645 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21575225..21575610 295..680 1930 100 Plus
3L 28110227 3L 21575670..21575879 681..890 1035 99.5 Plus
3L 28110227 3L 21574743..21574911 128..296 845 100 Plus
3L 28110227 3L 21574559..21574687 1..129 645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21568325..21568710 295..680 1930 100 Plus
3L 28103327 3L 21568770..21568979 681..890 1035 99.5 Plus
3L 28103327 3L 21567843..21568011 128..296 845 100 Plus
3L 28103327 3L 21567659..21567787 1..129 645 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:19:29 has no hits.

RE66462.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:20:07 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21563495..21563622 1..128 100 -> Plus
chr3L 21563680..21563847 129..296 100 -> Plus
chr3L 21564163..21564546 297..680 99 -> Plus
chr3L 21564606..21564810 681..885 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:04 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RC 1..684 69..752 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:34:14 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RC 1..684 69..752 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:38 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RC 1..684 69..752 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:18:08 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RA 1..621 69..690 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:16:43 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RC 1..684 69..752 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:40:25 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RC 1..885 1..885 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:34:14 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RC 1..885 1..885 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:38 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RC 3..887 1..885 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:18:08 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RA 1..689 1..690 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:16:43 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
CG32441-RC 3..887 1..885 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:20:07 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21574559..21574686 1..128 100 -> Plus
3L 21574744..21574911 129..296 100 -> Plus
3L 21575227..21575610 297..680 100 -> Plus
3L 21575670..21575874 681..885 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:20:07 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21574559..21574686 1..128 100 -> Plus
3L 21574744..21574911 129..296 100 -> Plus
3L 21575227..21575610 297..680 100 -> Plus
3L 21575670..21575874 681..885 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:20:07 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21574559..21574686 1..128 100 -> Plus
3L 21574744..21574911 129..296 100 -> Plus
3L 21575227..21575610 297..680 100 -> Plus
3L 21575670..21575874 681..885 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:38 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21567659..21567786 1..128 100 -> Plus
arm_3L 21567844..21568011 129..296 100 -> Plus
arm_3L 21568327..21568710 297..680 100 -> Plus
arm_3L 21568770..21568974 681..885 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:55:15 Download gff for RE66462.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21568327..21568710 297..680 100 -> Plus
3L 21568770..21568974 681..885 100   Plus
3L 21567659..21567786 1..128 100 -> Plus
3L 21567844..21568011 129..296 100 -> Plus

RE66462.hyp Sequence

Translation from 2 to 751

> RE66462.hyp
HSIGNPQTIEKLKLKLSVWQGNMYSKAGFVLIFVLGLVSSSWGFLEHDSW
ITVELQHSLAANSESFSFRGNVTIPSLNSGLANVEQPDLSTADLDLLKKL
ALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGY
VTGITVSQDTAPATIECTQEDVNKLLETQFSTDVLIRHAELAPVPDTAGF
IQKVEREREARERGEVRDNRGFFAKYWMYIVPVVLLVFISGATNQDGAK*

RE66462.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG32441-PC 227 CG32441-PC 1..227 23..249 1154 100 Plus
CG32441-PD 214 CG32441-PD 2..214 37..249 1056 97.2 Plus

RE66462.pep Sequence

Translation from 2 to 751

> RE66462.pep
HSIGNPQTIEKLKLKLSVWQGNMYSKAGFVLIFVLGLVSSSWGFLEHDSW
ITVELQHSLAANSESFSFRGNVTIPSLNSGLANVEQPDLSTADLDLLKKL
ALGNEFYRLKATVVYSNGAKAQFITSNKACRLLQAQLNDVLWVSLEPSGY
VTGITVSQDTAPATIECTQEDVNKLLETQFSTDVLIRHAELAPVPDTAGF
IQKVEREREARERGEVRDNRGFFAKYWMYIVPVVLLVFISGATNQDGAK*

RE66462.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23728-PA 227 GF23728-PA 1..227 23..249 917 82.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16204-PA 227 GG16204-PA 1..227 23..249 1008 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14182-PA 224 GH14182-PA 2..224 28..249 716 65 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG32441-PC 227 CG32441-PC 1..227 23..249 1154 100 Plus
CG32441-PD 214 CG32441-PD 2..214 37..249 1056 97.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22092-PA 228 GI22092-PA 1..228 23..249 704 64 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18105-PA 224 GL18105-PA 5..224 30..249 927 76.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16906-PA 224 GA16906-PA 5..224 30..249 927 76.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22386-PA 218 GM22386-PA 8..211 23..226 1065 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17649-PA 211 GD17649-PA 1..204 23..226 1068 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24207-PA 228 GJ24207-PA 1..228 23..249 733 65.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18047-PA 227 GK18047-PA 1..227 23..249 818 72.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23269-PA 227 GE23269-PA 1..227 23..249 1010 95.2 Plus
Dyak\GE19774-PA 227 GE19774-PA 1..227 23..249 1010 95.2 Plus