Clone RE66521 Report

Search the DGRC for RE66521

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:665
Well:21
Vector:pFlc-1
Associated Gene/TranscriptCyt-b5-RB
Protein status:RE66521.pep: gold
Preliminary Size:775
Sequenced Size:843

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2140 2002-01-01 Sim4 clustering to Release 2
CG2140 2003-02-20 Blastp of sequenced clone
Cyt-b5 2008-04-29 Release 5.5 accounting
Cyt-b5 2008-08-15 Release 5.9 accounting
Cyt-b5 2008-12-18 5.12 accounting

Clone Sequence Records

RE66521.complete Sequence

843 bp (843 high quality bases) assembled on 2003-02-20

GenBank Submission: BT004852

> RE66521.complete
AGTTCTGTGAGACCGTGCGCCCTGGAGGAAGAGTGCGAGGCTGGACAAAT
AGTTTTTCCGTGACACAAATCAAACGCGCAGTAGAAATCAACAAGTGATC
ACCATGTCGAGCGAGGAAACAAAGACTTTCACGCGGGCCGAGGTCGCCAA
GCACAACACGAACAAGGACACCTGGCTGCTCATACACAACAACATCTACG
ACGTCACCGCCTTCCTCAACGAGCATCCCGGTGGCGAAGAGGTGCTCATC
GAGCAGGCCGGCAAAGATGCCACGGAGAACTTTGAGGACGTTGGCCACAG
CAACGATGCCCGCGACATGATGAAGAAGTACAAAATCGGTGAGCTGGTGG
AGAGCGAAAGGACAAGCGTGGCCCAGAAGTCGGAGCCGACCTGGAGCACG
GAACAGCAAACCGAGGAGAGTTCTGTGAAGTCGTGGCTGGTGCCCCTCGT
CCTGTGCTTGGTGGCCACGCTCTTCTACAAGTTCTTCTTTGGCGGTGCCA
AGCAATAGGAGGAGCCACAATGCCCAGCAGAGACTTTCCAGCCCGCTCCG
GAGTCGCTTAGTTAATCAACAAACGGAGAGCCCGAGAGTCACATGAGGAG
CGGGACAGTGGAGCGGGAAAGCTTTTTATAGTAAATTTGTGCTAAGTTTT
AACGATAATTTTTGGCATTTGGCGTTTTTGTACAACCCTCTACACGTGTA
ATTCCTTCAGACGGCGGTTCTAGACTCTAAAAGTAATTTATCCCATTGAT
ATTCCAACATTTGAGGCACGGAACGAAAACGATAAGTTTTTATTCGCATG
TATGTACATTAAACATATTTCCAAAAGCAAAAAAAAAAAAAAA

RE66521.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-b5-RB 908 Cyt-b5-RB 81..908 1..828 4140 100 Plus
Cyt-b5-RA 692 Cyt-b5-RA 88..692 224..828 3025 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3422679..3423285 222..828 3035 100 Plus
chr2R 21145070 chr2R 3420858..3421080 1..223 1115 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7535330..7535938 222..830 3045 100 Plus
2R 25286936 2R 7533508..7533730 1..223 1115 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7536529..7537137 222..830 3045 100 Plus
2R 25260384 2R 7534707..7534929 1..223 1115 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:06:06 has no hits.

RE66521.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:07:08 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3420858..3421080 1..223 100 -> Plus
chr2R 3422681..3423285 224..828 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:08 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 1..405 104..508 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:52 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 1..405 104..508 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:59:02 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 1..405 104..508 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:47 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 1..405 104..508 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:59:43 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 1..405 104..508 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:00 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 1..828 1..828 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:52 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 1..828 1..828 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:59:02 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 3..830 1..828 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:30:47 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 1..828 1..828 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:59:43 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-b5-RB 3..830 1..828 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:08 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7533508..7533730 1..223 100 -> Plus
2R 7535332..7535936 224..828 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:08 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7533508..7533730 1..223 100 -> Plus
2R 7535332..7535936 224..828 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:08 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7533508..7533730 1..223 100 -> Plus
2R 7535332..7535936 224..828 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:59:02 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3421013..3421235 1..223 100 -> Plus
arm_2R 3422837..3423441 224..828 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:09:15 Download gff for RE66521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7534707..7534929 1..223 100 -> Plus
2R 7536531..7537135 224..828 100   Plus

RE66521.pep Sequence

Translation from 103 to 507

> RE66521.pep
MSSEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIE
QAGKDATENFEDVGHSNDARDMMKKYKIGELVESERTSVAQKSEPTWSTE
QQTEESSVKSWLVPLVLCLVATLFYKFFFGGAKQ*

RE66521.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13182-PA 134 GF13182-PA 1..134 1..134 690 96.3 Plus
Dana\GF20301-PA 117 GF20301-PA 2..81 6..85 238 53.8 Plus
Dana\GF10319-PA 119 GF10319-PA 2..105 6..107 217 42.3 Plus
Dana\GF15091-PA 138 GF15091-PA 49..122 13..86 216 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23285-PA 134 GG23285-PA 1..134 1..134 711 99.3 Plus
Dere\GG17685-PA 117 GG17685-PA 2..86 6..93 238 51.1 Plus
Dere\GG21732-PA 137 GG21732-PA 39..116 4..81 216 46.2 Plus
Dere\GG13493-PA 119 GG13493-PA 2..102 6..108 214 41.9 Plus
Dere\GG21968-PA 535 GG21968-PA 91..166 10..85 140 34.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20101-PA 134 GH20101-PA 1..134 1..134 624 84.3 Plus
Dgri\GH24801-PA 118 GH24801-PA 2..92 6..100 234 46.3 Plus
Dgri\GH10148-PA 140 GH10148-PA 47..124 9..86 215 46.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-b5-PB 134 CG2140-PB 1..134 1..134 700 100 Plus
Cyt-b5-PA 123 CG2140-PA 27..123 38..134 491 96.9 Plus
CG3566-PC 89 CG3566-PC 2..81 6..85 235 52.5 Plus
CG3566-PD 106 CG3566-PD 2..81 6..85 235 52.5 Plus
CG3566-PB 117 CG3566-PB 2..81 6..85 235 52.5 Plus
CG5157-PA 119 CG5157-PA 2..112 6..110 216 42.3 Plus
CG6870-PB 137 CG6870-PB 39..116 4..81 206 46.2 Plus
CG6870-PA 137 CG6870-PA 39..116 4..81 206 46.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18997-PA 135 GI18997-PA 1..134 1..134 634 87.3 Plus
Dmoj\GI21528-PA 117 GI21528-PA 2..81 6..85 218 47.5 Plus
Dmoj\GI22344-PA 139 GI22344-PA 46..118 9..81 205 47.9 Plus
Dmoj\GI12677-PA 121 GI12677-PA 2..80 6..82 204 43 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20014-PA 135 GL20014-PA 1..134 1..134 636 86.6 Plus
Dper\GL21352-PA 118 GL21352-PA 8..81 12..85 220 52.7 Plus
Dper\GL15857-PA 138 GL15857-PA 36..121 1..86 216 43 Plus
Dper\GL18032-PA 132 GL18032-PA 2..79 6..81 211 48.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15264-PA 135 GA15264-PA 1..134 1..134 636 86.6 Plus
Dpse\GA17524-PA 118 GA17524-PA 2..81 6..85 223 50 Plus
Dpse\GA18697-PA 132 GA18697-PA 2..79 6..81 211 48.7 Plus
Dpse\GA19919-PA 138 GA19919-PA 48..121 13..86 211 47.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20961-PA 134 GM20961-PA 1..134 1..134 700 97.8 Plus
Dsec\GM24442-PA 119 GM24442-PA 2..110 6..105 217 42.2 Plus
Dsec\GM17113-PA 137 GM17113-PA 39..116 4..81 214 46.2 Plus
Dsec\GM21957-PA 535 GM21957-PA 91..177 10..96 141 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10488-PA 134 GD10488-PA 1..134 1..134 700 97.8 Plus
Dsim\GD12511-PA 119 GD12511-PA 2..79 6..81 218 51.3 Plus
Dsim\GD21856-PA 136 GD21856-PA 39..115 4..81 196 46.2 Plus
Dsim\GD11452-PA 535 GD11452-PA 91..177 10..96 141 31 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19962-PA 135 GJ19962-PA 1..134 1..134 662 91 Plus
Dvir\GJ16001-PA 117 GJ16001-PA 2..117 6..134 232 38.8 Plus
Dvir\GJ12661-PA 120 GJ12661-PA 2..114 6..107 211 37.2 Plus
Dvir\GJ20242-PA 104 GJ20242-PA 24..87 22..85 186 45.3 Plus
Dvir\GJ20792-PA 539 GJ20792-PA 92..166 10..84 143 36 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10686-PA 133 GK10686-PA 1..133 1..133 645 87.2 Plus
Dwil\GK19965-PA 118 GK19965-PA 4..83 7..86 221 50 Plus
Dwil\GK18221-PA 140 GK18221-PA 46..123 9..86 221 47.4 Plus
Dwil\GK11351-PA 124 GK11351-PA 2..103 6..96 216 41.2 Plus
Dwil\GK22167-PA 528 GK22167-PA 84..168 10..96 145 35.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19131-PA 134 GE19131-PA 1..134 1..134 704 98.5 Plus
Dyak\GE16473-PA 117 GE16473-PA 2..86 6..93 235 48.9 Plus
Dyak\GE22584-PA 119 GE22584-PA 2..112 6..110 223 42.9 Plus
Dyak\GE13120-PA 137 GE13120-PA 39..116 4..81 215 46.2 Plus

RE66521.hyp Sequence

Translation from 103 to 507

> RE66521.hyp
MSSEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIE
QAGKDATENFEDVGHSNDARDMMKKYKIGELVESERTSVAQKSEPTWSTE
QQTEESSVKSWLVPLVLCLVATLFYKFFFGGAKQ*

RE66521.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-b5-PB 134 CG2140-PB 1..134 1..134 700 100 Plus
Cyt-b5-PA 123 CG2140-PA 27..123 38..134 491 96.9 Plus
CG3566-PC 89 CG3566-PC 2..81 6..85 235 52.5 Plus
CG3566-PD 106 CG3566-PD 2..81 6..85 235 52.5 Plus
CG3566-PB 117 CG3566-PB 2..81 6..85 235 52.5 Plus