Clone RE66546 Report

Search the DGRC for RE66546

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:665
Well:46
Vector:pFlc-1
Associated Gene/TranscriptCG10219-RA
Protein status:RE66546.pep: gold
Sequenced Size:908

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10219 2001-12-14 Blastp of sequenced clone
CG10219 2002-01-01 Sim4 clustering to Release 2
CG10219 2003-01-01 Sim4 clustering to Release 3
CG10219 2008-04-29 Release 5.5 accounting
CG10219 2008-08-15 Release 5.9 accounting
CG10219 2008-12-18 5.12 accounting

Clone Sequence Records

RE66546.complete Sequence

908 bp (908 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071617

> RE66546.complete
GAGGCCAGTGCTGTGTAATTTTTTAGACAAATCGGCCCAAACCGAACGGA
GCGATAGAGTTTTTATTTTGAGCTGAAAATTCTCAATATTTACACATCCC
AACATGTCCCTCTCGTTGCTTCTGCGTGGCGCTGTCCGTTGCAATGCCGC
AAATCTTGTTAAGTCGGCTCGCATCACTCCCCTGAAGAGCTACTCCACCC
TGGTGGCCAATGTCCAGCGGAAGGCGGTGGTCCAGCCCCTGGCCGTGGCC
AAGATTGTAGCGCCCGTCGTGCGCGAGATCTCCGTGAGTGCGCCCCGCAT
GGCTTCCGCTGGATCCAGCCACACCCTGCTCTGGACTGTGGAGCGAATTG
TGTCCGCCGGCCTACTGGCCGTCATTCCAGCTGCCTTCATAGCTCCATCC
CAGGTATTGGACGCCCTCATGGCCATCTCTGTCGTCATCCACACCCATTG
GGGCGTGGAGGCCATGGTAGTTGACTACATGCGGCCATCTGTCGTTGGAA
ACGTCCTGCCCAAGGTAGCCCACATTGCGCTGATCATCATCTCGGTGGCC
ACGCTGGGCGGCCTCTTCTACTTCATCCAAAATGATGTGGGTCTGGCCAA
TGGTATCAAGCGCTTCTGGGCCATCAAGGGCAAGGATGCCGAGAAGGCTT
AAATGTCAAAGGAGCAATCAGTTGATGAACCACGAAACACCAGTTATTTA
TTCATAGTTTCGCGATAAGCATTAAATAAAGAATTGTAAAAAGTCACAGC
TGCACAGAGCGGGTTTTGTAGAAAATTGTATATTCAACAAGAAAATCAGC
ACTAAAGTAGTTGGGTAACAGGCACCACCTTTGTTACGTATGGTAATCTA
CTGTAAACAATAAATTTGGGCTATTGGCCAGGTTTGGTCATCAAAAAAAA
AAAAAAAA

RE66546.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG10219-RA 956 CG10219-RA 67..953 5..891 4420 99.8 Plus
Plip.a 932 Plip.a 796..932 891..755 670 99.2 Minus
Plip.b 945 Plip.b 809..945 891..755 670 99.2 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19582891..19583332 891..450 2195 99.8 Minus
chr3R 27901430 chr3R 19583392..19583581 451..262 950 100 Minus
chr3R 27901430 chr3R 19583860..19584001 146..5 710 100 Minus
chr3R 27901430 chr3R 19583653..19583769 262..146 585 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23759483..23759924 891..450 2195 99.8 Minus
3R 32079331 3R 23759984..23760173 451..262 950 100 Minus
3R 32079331 3R 23760452..23760593 146..5 710 100 Minus
3R 32079331 3R 23760245..23760361 262..146 585 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23500314..23500755 891..450 2195 99.7 Minus
3R 31820162 3R 23500815..23501004 451..262 950 100 Minus
3R 31820162 3R 23501283..23501424 146..5 710 100 Minus
3R 31820162 3R 23501076..23501192 262..146 585 100 Minus
Blast to na_te.dros performed 2019-03-16 06:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Vege 884 Dwil\Vege VEGE 884bp Derived from AF518730. 327..377 886..835 113 71.2 Minus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 4332..4359 722..749 113 89.3 Plus

RE66546.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:11:57 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19582890..19583331 451..892 99 <- Minus
chr3R 19583393..19583580 263..450 100 <- Minus
chr3R 19583653..19583768 147..262 100 <- Minus
chr3R 19583860..19584004 1..146 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:09 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 1..549 104..652 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:16 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 1..549 104..652 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:38:55 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 1..549 104..652 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:31 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 1..549 104..652 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:13:32 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 1..549 104..652 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:38:35 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 1..888 2..889 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:16 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 1..888 2..889 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:38:55 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 4..894 1..891 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:31 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 1..888 2..889 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:13:32 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
CG10219-RA 4..894 1..891 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:57 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23759482..23759923 451..892 99 <- Minus
3R 23759985..23760172 263..450 100 <- Minus
3R 23760245..23760360 147..262 100 <- Minus
3R 23760452..23760596 1..146 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:57 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23759482..23759923 451..892 99 <- Minus
3R 23759985..23760172 263..450 100 <- Minus
3R 23760245..23760360 147..262 100 <- Minus
3R 23760452..23760596 1..146 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:57 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23759482..23759923 451..892 99 <- Minus
3R 23759985..23760172 263..450 100 <- Minus
3R 23760245..23760360 147..262 100 <- Minus
3R 23760452..23760596 1..146 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:38:55 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19585204..19585645 451..892 99 <- Minus
arm_3R 19585707..19585894 263..450 100 <- Minus
arm_3R 19585967..19586082 147..262 100 <- Minus
arm_3R 19586174..19586318 1..146 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:34 Download gff for RE66546.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23501076..23501191 147..262 100 <- Minus
3R 23501283..23501427 1..146 98   Minus
3R 23500816..23501003 263..450 100 <- Minus
3R 23500313..23500754 451..892 99 <- Minus

RE66546.hyp Sequence

Translation from 103 to 651

> RE66546.hyp
MSLSLLLRGAVRCNAANLVKSARITPLKSYSTLVANVQRKAVVQPLAVAK
IVAPVVREISVSAPRMASAGSSHTLLWTVERIVSAGLLAVIPAAFIAPSQ
VLDALMAISVVIHTHWGVEAMVVDYMRPSVVGNVLPKVAHIALIIISVAT
LGGLFYFIQNDVGLANGIKRFWAIKGKDAEKA*

RE66546.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG10219-PA 182 CG10219-PA 1..182 1..182 888 100 Plus

RE66546.pep Sequence

Translation from 103 to 651

> RE66546.pep
MSLSLLLRGAVRCNAANLVKSARITPLKSYSTLVANVQRKAVVQPLAVAK
IVAPVVREISVSAPRMASAGSSHTLLWTVERIVSAGLLAVIPAAFIAPSQ
VLDALMAISVVIHTHWGVEAMVVDYMRPSVVGNVLPKVAHIALIIISVAT
LGGLFYFIQNDVGLANGIKRFWAIKGKDAEKA*

RE66546.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18741-PA 178 GF18741-PA 1..177 1..178 739 83.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12408-PA 182 GG12408-PA 1..182 1..182 907 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11519-PA 181 GH11519-PA 4..180 4..179 755 79.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
SdhD-PA 182 CG10219-PA 1..182 1..182 888 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22398-PA 182 GI22398-PA 4..182 4..181 734 77.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24273-PA 184 GL24273-PA 1..180 1..181 820 85.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10165-PA 184 GA10165-PA 1..180 1..181 820 85.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23542-PA 182 GM23542-PA 1..182 1..182 910 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18356-PA 182 GD18356-PA 1..182 1..182 915 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24648-PA 184 GJ24648-PA 4..182 4..181 734 77.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22767-PA 181 GK22767-PA 1..179 1..181 733 78.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23927-PA 182 GE23927-PA 1..182 1..182 890 95.1 Plus