Clone RE67096 Report

Search the DGRC for RE67096

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:670
Well:96
Vector:pFlc-1
Associated Gene/TranscriptCG10131-RA
Protein status:RE67096.pep: gold
Sequenced Size:1071

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10131 2003-01-01 Sim4 clustering to Release 3
CG10131 2004-10-25 Blastp of sequenced clone
CG10131 2008-04-29 Release 5.5 accounting
CG10131 2008-08-15 Release 5.9 accounting
CG10131 2008-12-18 5.12 accounting

Clone Sequence Records

RE67096.complete Sequence

1071 bp (1071 high quality bases) assembled on 2004-10-25

GenBank Submission: BT015982

> RE67096.complete
AGTTCGAAATGAGCAGCCAAAAGATTGGGATCGTGGGCAGTGGACTGATC
GGCAGGGCGTGGGCGATGCTCTTTGCAGCAGCTGGCTATCGTGTCCAACT
GTATGACATCCTGGAGAGCCAGTTGGCCACTGCGCTGCAGGAGCTGGACA
AGGATTTGCATCGGCTGGAGGAGCAGAGCGCGTTGCGTGGCAATATACGG
GCCTCGGAACAGTTTGCCCTGATCGGGGTCACCACTCGACTAGAGGAACT
CACCAGGGAGGCGGTGCACATACAGGAGTGTGTTCCCGAAGTTTTGCATC
TGAAGAAGAGTCTGTACTCGCAGTTGGATGAGCTGCTCGAGGAGCAGACA
GTGGTGGCCAGTTCCACGAGCACCTTTATGCCATCGCTGTACAGCGAGGG
TCTGCAAAAGAGACAACAGATGCTAGTGGCTCATCCACTGAACCCGCCGT
ATTTTATACCCCTGGTAGAGATTGTCCCAGCTCCCTGGACATCCCCGAGT
GCGGTGGAGCGAACCCGTGACCTAATGCTCAGCCTGGGCCAACGTCCGGT
AACTTTAAAAAGAGAGATTCAGGGCTTCGCCACCAATCGGATTCAGTATG
CCATTCTGAACGAGGTGTGGCGCCTGGTGGGCTCCGGTATCCTCAGCGTG
GCCGATGTGGATCGAGTTCTCAGCCAGGGCTTGGGATTGCGATATGCCCT
GCTAGGATCCCTGGAGACAGCCCATCTGAATGCGCCTGGTGGTGTGGCTG
ACTACTTCCAGCGTTTTGGTGGGGAAATCTCTGCGGTGAGTGCCACCTAT
GGAGAGACCCCGAATACCCAGGAGGATCGGGAAACGCTGGCCGAGATTGC
ACGGCAGTGTGAGCAGCTGGTGTCACTGGAAAAACTCGACGAGAGGCGGG
CCGTTCGTGATGAATTCCTCATCCAACTGGCCAAACTGAAGAAGCAGTTT
GAATAGGATATTAATTGCTGCGTTTGTGATGTTCGCTGAATAAACTGCGA
GCCAACTTAATGGCCCGGCGTAGTCTTACTCTGCTCCTTGGCTCGCTTCT
CCAGCAAAAAAAAAAAAAAAA

RE67096.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG10131-RA 1318 CG10131-RA 167..1221 1..1055 5275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10517686..10518326 415..1055 3205 100 Plus
chr2R 21145070 chr2R 10517216..10517634 1..419 2095 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14630383..14631023 415..1055 3205 100 Plus
2R 25286936 2R 14629913..14630331 1..419 2095 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14631582..14632222 415..1055 3205 100 Plus
2R 25260384 2R 14631112..14631530 1..419 2095 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:09:46 has no hits.

RE67096.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:10:45 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10517216..10517634 1..419 100 -> Plus
chr2R 10517691..10518326 420..1055 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:27 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 1..948 9..956 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:29:01 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 1..948 9..956 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:03:53 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 1..948 9..956 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:12:59 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 1..948 9..956 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:30:13 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 1..948 9..956 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:32:46 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 1..1053 1..1053 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:29:00 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 1..1053 1..1053 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:03:53 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 4..1058 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:12:59 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 1..1053 1..1053 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:30:13 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
CG10131-RA 4..1058 1..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:45 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14629913..14630331 1..419 100 -> Plus
2R 14630388..14631023 420..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:45 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14629913..14630331 1..419 100 -> Plus
2R 14630388..14631023 420..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:45 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14629913..14630331 1..419 100 -> Plus
2R 14630388..14631023 420..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:03:53 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10517418..10517836 1..419 100 -> Plus
arm_2R 10517893..10518528 420..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:49:37 Download gff for RE67096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14631112..14631530 1..419 100 -> Plus
2R 14631587..14632222 420..1055 100   Plus

RE67096.hyp Sequence

Translation from 2 to 955

> RE67096.hyp
FEMSSQKIGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDK
DLHRLEEQSALRGNIRASEQFALIGVTTRLEELTREAVHIQECVPEVLHL
KKSLYSQLDELLEEQTVVASSTSTFMPSLYSEGLQKRQQMLVAHPLNPPY
FIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATNRIQYA
ILNEVWRLVGSGILSVADVDRVLSQGLGLRYALLGSLETAHLNAPGGVAD
YFQRFGGEISAVSATYGETPNTQEDRETLAEIARQCEQLVSLEKLDERRA
VRDEFLIQLAKLKKQFE*

RE67096.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG10131-PA 315 CG10131-PA 1..315 3..317 1570 100 Plus
CG9914-PB 315 CG9914-PB 5..312 5..315 884 55.9 Plus
CG9914-PA 315 CG9914-PA 5..312 5..315 884 55.9 Plus
Mtpalpha-PB 744 CG4389-PB 331..539 2..213 165 24.1 Plus
Mtpalpha-PA 783 CG4389-PA 370..578 2..213 165 24.1 Plus

RE67096.pep Sequence

Translation from 8 to 955

> RE67096.pep
MSSQKIGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDL
HRLEEQSALRGNIRASEQFALIGVTTRLEELTREAVHIQECVPEVLHLKK
SLYSQLDELLEEQTVVASSTSTFMPSLYSEGLQKRQQMLVAHPLNPPYFI
PLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATNRIQYAIL
NEVWRLVGSGILSVADVDRVLSQGLGLRYALLGSLETAHLNAPGGVADYF
QRFGGEISAVSATYGETPNTQEDRETLAEIARQCEQLVSLEKLDERRAVR
DEFLIQLAKLKKQFE*

RE67096.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11336-PA 315 GF11336-PA 1..315 1..315 1398 83.2 Plus
Dana\GF19071-PA 317 GF19071-PA 3..314 1..315 945 55.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20470-PA 315 GG20470-PA 1..315 1..315 1585 95.6 Plus
Dere\GG19334-PA 315 GG19334-PA 5..314 3..315 927 55.9 Plus
Dere\GG24022-PA 783 GG24022-PA 374..578 4..211 153 23.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22921-PA 315 GH22921-PA 1..314 1..314 1245 75.5 Plus
Dgri\GH12278-PA 318 GH12278-PA 7..316 3..315 937 55.6 Plus
Dgri\GH11058-PA 785 GH11058-PA 376..580 4..211 160 23.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Had2-PA 315 CG10131-PA 1..315 1..315 1570 100 Plus
Had1-PB 315 CG9914-PB 5..312 3..313 884 55.9 Plus
Had1-PA 315 CG9914-PA 5..312 3..313 884 55.9 Plus
Mtpalpha-PB 744 CG4389-PB 337..539 6..211 164 24.3 Plus
Mtpalpha-PA 783 CG4389-PA 376..578 6..211 164 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18410-PA 315 GI18410-PA 1..314 1..314 1274 76.1 Plus
Dmoj\GI10976-PA 313 GI10976-PA 3..310 5..315 943 55.6 Plus
Dmoj\GI17575-PA 791 GI17575-PA 382..586 4..211 154 25.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11451-PA 318 GL11451-PA 5..318 2..315 1383 85 Plus
Dper\GL21343-PA 318 GL21343-PA 7..316 3..315 930 55 Plus
Dper\GL19219-PA 787 GL19219-PA 377..582 3..211 155 25 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10097-PA 318 GA10097-PA 5..318 2..315 1392 85.7 Plus
Dpse\GA23040-PA 318 GA23040-PA 7..316 3..315 928 55 Plus
Dpse\GA18151-PA 787 GA18151-PA 377..582 3..211 155 25 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21560-PA 315 GM21560-PA 1..315 1..315 1617 98.1 Plus
Dsec\GM13412-PA 318 GM13412-PA 8..317 3..315 925 55.6 Plus
Dsec\GM12408-PA 783 GM12408-PA 374..578 4..211 160 24.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11066-PA 315 GD11066-PA 1..315 1..315 1614 98.1 Plus
Dsim\GD24495-PA 153 GD24495-PA 3..151 163..314 411 54.6 Plus
Dsim\GD22351-PA 783 GD22351-PA 374..578 4..211 160 24.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21492-PA 315 GJ21492-PA 1..314 1..314 1285 77.1 Plus
Dvir\GJ18534-PA 318 GJ18534-PA 9..316 5..315 909 54 Plus
Dvir\GJ17917-PA 788 GJ17917-PA 379..583 4..211 152 25.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19629-PA 315 GK19629-PA 1..315 1..315 1325 78.1 Plus
Dwil\GK25055-PA 316 GK25055-PA 8..315 5..315 938 55.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13601-PA 315 GE13601-PA 1..315 1..315 1583 96.2 Plus
Dyak\GE11007-PA 315 GE11007-PA 5..314 3..315 921 55.3 Plus
Dyak\GE10479-PA 783 GE10479-PA 374..578 4..211 160 24.5 Plus