BDGP Sequence Production Resources |
Search the DGRC for RE67445
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 674 |
Well: | 45 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG2811-RA |
Protein status: | RE67445.pep: gold |
Preliminary Size: | 489 |
Sequenced Size: | 716 |
Gene | Date | Evidence |
---|---|---|
CG2811 | 2001-12-14 | Blastp of sequenced clone |
CG2811 | 2002-01-01 | Sim4 clustering to Release 2 |
CG2811 | 2003-01-01 | Sim4 clustering to Release 3 |
CG2811 | 2008-04-29 | Release 5.5 accounting |
CG2811 | 2008-08-15 | Release 5.9 accounting |
CG2811 | 2008-12-18 | 5.12 accounting |
716 bp (716 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071623
> RE67445.complete CGCGATCTACAGGTCGGATTTGATAGCACGATACCGCTTGAAACTGATAA GCCTGGCGGCGGGAAGCGCAATGGCTGAAAAGCTGAGAATGGCGGCAAGG GTCTTTGTGTATGGCACGTTGAAGCGCGGTGAGCCCAATCACCACTGGCT GACGAAAAAGGAGAACGGCCAAGCCCGATTCCTTGGAAGGGGGAAAACGG AAACGAAGTTTCCCCTGGTTGTCGGAACCCGCTACAACATCCCATTTCTG CTCGCCCGCCCGGGTGAGGGGAACCACATAGAAGGCGAAGTCTACGAAGT GGACGAGACCATGCTCTCCAAACTGGACATACTAGAAGACTACCCGGACT ACTATGATCGCGAGCAACAAACCATATTAATGGAACAGAATGAAACCATT CAGTGCTGGCTGTACCTGATTCGCAACTTCCCAGACAAGATGCTGGCCAA GGAGCTGCTGATCTCGTACCACAACACGCCGGAGAGGCCGTACAATGAAA AGTCAGTACGCACTGTTTCAGCCAGAGATGATCTTTCTTACTGATTTTGC AGCTACTTGGACAGCTGCCCGGAAGACCTCGCCATGGAAAAGTGAGAAAC GGAAACGTATAAAAAAGTAACGTTTATAAACGGATTTCAACGCATGGGTA TTATTCGTATTGTATTACATTAATCCATTTTTCAAAATGCAAAACGAAAT GAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2811-RA | 861 | CG2811-RA | 119..821 | 1..703 | 3500 | 99.8 | Plus |
CG2811.c | 810 | CG2811.c | 119..619 | 1..501 | 2490 | 99.8 | Plus |
CG2811.a | 662 | CG2811.a | 20..412 | 1..393 | 1950 | 99.7 | Plus |
CG2811.c | 810 | CG2811.c | 620..770 | 553..703 | 755 | 100 | Plus |
CG2811.a | 662 | CG2811.a | 511..661 | 553..703 | 755 | 100 | Plus |
CG2811.a | 662 | CG2811.a | 413..510 | 404..501 | 490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 20825660..20825967 | 394..701 | 100 | <- | Minus |
chr2R | 20826026..20826418 | 1..393 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 1..474 | 71..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 1..474 | 71..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 1..474 | 71..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 1..474 | 71..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 1..474 | 71..544 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 7..707 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 7..707 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 20..720 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 7..707 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2811-RA | 20..720 | 1..701 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24939706..24940013 | 394..701 | 100 | <- | Minus |
2R | 24940072..24940464 | 1..393 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24939706..24940013 | 394..701 | 100 | <- | Minus |
2R | 24940072..24940464 | 1..393 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24939706..24940013 | 394..701 | 100 | <- | Minus |
2R | 24940072..24940464 | 1..393 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 20827595..20827987 | 1..393 | 99 | Minus | |
arm_2R | 20827229..20827536 | 394..701 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24940923..24941230 | 394..701 | 100 | <- | Minus |
2R | 24941289..24941681 | 1..393 | 99 | Minus |
Translation from 0 to 543
> RE67445.hyp AIYRSDLIARYRLKLISLAAGSAMAEKLRMAARVFVYGTLKRGEPNHHWL TKKENGQARFLGRGKTETKFPLVVGTRYNIPFLLARPGEGNHIEGEVYEV DETMLSKLDILEDYPDYYDREQQTILMEQNETIQCWLYLIRNFPDKMLAK ELLISYHNTPERPYNEKSVRTVSARDDLSY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2811-PA | 157 | CG2811-PA | 1..157 | 24..180 | 835 | 100 | Plus |
CG2811-PB | 157 | CG2811-PB | 1..143 | 24..166 | 768 | 100 | Plus |
CG2811-PC | 151 | CG2811-PC | 1..137 | 30..166 | 740 | 100 | Plus |
Tina-1-PA | 167 | CG2803-PA | 4..163 | 25..180 | 336 | 43.8 | Plus |
Tina-1-PB | 84 | CG2803-PB | 1..80 | 104..180 | 139 | 38.8 | Plus |
Translation from 70 to 543
> RE67445.pep MAEKLRMAARVFVYGTLKRGEPNHHWLTKKENGQARFLGRGKTETKFPLV VGTRYNIPFLLARPGEGNHIEGEVYEVDETMLSKLDILEDYPDYYDREQQ TILMEQNETIQCWLYLIRNFPDKMLAKELLISYHNTPERPYNEKSVRTVS ARDDLSY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11525-PA | 153 | GF11525-PA | 1..153 | 7..157 | 672 | 80.4 | Plus |
Dana\GF11524-PA | 167 | GF11524-PA | 12..163 | 9..157 | 354 | 46.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19876-PA | 157 | GG19876-PA | 1..154 | 1..156 | 756 | 91 | Plus |
Dere\GG19875-PA | 167 | GG19875-PA | 4..163 | 2..157 | 338 | 43.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22049-PA | 156 | GH22049-PA | 2..156 | 5..157 | 577 | 66.5 | Plus |
Dgri\GH22048-PA | 167 | GH22048-PA | 1..163 | 1..157 | 347 | 44.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2811-PA | 157 | CG2811-PA | 1..157 | 1..157 | 835 | 100 | Plus |
CG2811-PB | 157 | CG2811-PB | 1..143 | 1..143 | 768 | 100 | Plus |
CG2811-PC | 151 | CG2811-PC | 1..137 | 7..143 | 740 | 100 | Plus |
Tina-1-PA | 167 | CG2803-PA | 4..163 | 2..157 | 336 | 43.8 | Plus |
Tina-1-PB | 84 | CG2803-PB | 1..80 | 81..157 | 139 | 38.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19135-PA | 156 | GI19135-PA | 1..156 | 1..157 | 577 | 66.7 | Plus |
Dmoj\GI19134-PA | 168 | GI19134-PA | 12..163 | 9..157 | 350 | 46.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10896-PA | 153 | GL10896-PA | 1..153 | 7..157 | 625 | 75.8 | Plus |
Dper\GL10895-PA | 167 | GL10895-PA | 12..163 | 9..157 | 361 | 47.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15469-PA | 153 | GA15469-PA | 1..153 | 7..157 | 619 | 75.2 | Plus |
Dpse\GA15466-PA | 167 | GA15466-PA | 12..163 | 9..157 | 361 | 47.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11777-PA | 157 | GM11777-PA | 1..154 | 1..156 | 762 | 92.9 | Plus |
Dsec\GM11776-PA | 167 | GM11776-PA | 4..163 | 2..157 | 340 | 43.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24907-PA | 157 | GD24907-PA | 1..154 | 1..156 | 770 | 93.6 | Plus |
Dsim\GD24906-PA | 167 | GD24906-PA | 4..163 | 2..157 | 339 | 43.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22268-PA | 156 | GJ22268-PA | 1..156 | 1..157 | 583 | 66.7 | Plus |
Dvir\GJ22267-PA | 168 | GJ22267-PA | 12..163 | 9..157 | 351 | 46.7 | Plus |