Clone RE67445 Report

Search the DGRC for RE67445

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:674
Well:45
Vector:pFlc-1
Associated Gene/TranscriptCG2811-RA
Protein status:RE67445.pep: gold
Preliminary Size:489
Sequenced Size:716

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2811 2001-12-14 Blastp of sequenced clone
CG2811 2002-01-01 Sim4 clustering to Release 2
CG2811 2003-01-01 Sim4 clustering to Release 3
CG2811 2008-04-29 Release 5.5 accounting
CG2811 2008-08-15 Release 5.9 accounting
CG2811 2008-12-18 5.12 accounting

Clone Sequence Records

RE67445.complete Sequence

716 bp (716 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071623

> RE67445.complete
CGCGATCTACAGGTCGGATTTGATAGCACGATACCGCTTGAAACTGATAA
GCCTGGCGGCGGGAAGCGCAATGGCTGAAAAGCTGAGAATGGCGGCAAGG
GTCTTTGTGTATGGCACGTTGAAGCGCGGTGAGCCCAATCACCACTGGCT
GACGAAAAAGGAGAACGGCCAAGCCCGATTCCTTGGAAGGGGGAAAACGG
AAACGAAGTTTCCCCTGGTTGTCGGAACCCGCTACAACATCCCATTTCTG
CTCGCCCGCCCGGGTGAGGGGAACCACATAGAAGGCGAAGTCTACGAAGT
GGACGAGACCATGCTCTCCAAACTGGACATACTAGAAGACTACCCGGACT
ACTATGATCGCGAGCAACAAACCATATTAATGGAACAGAATGAAACCATT
CAGTGCTGGCTGTACCTGATTCGCAACTTCCCAGACAAGATGCTGGCCAA
GGAGCTGCTGATCTCGTACCACAACACGCCGGAGAGGCCGTACAATGAAA
AGTCAGTACGCACTGTTTCAGCCAGAGATGATCTTTCTTACTGATTTTGC
AGCTACTTGGACAGCTGCCCGGAAGACCTCGCCATGGAAAAGTGAGAAAC
GGAAACGTATAAAAAAGTAACGTTTATAAACGGATTTCAACGCATGGGTA
TTATTCGTATTGTATTACATTAATCCATTTTTCAAAATGCAAAACGAAAT
GAAAAAAAAAAAAAAA

RE67445.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG2811-RA 861 CG2811-RA 119..821 1..703 3500 99.8 Plus
CG2811.c 810 CG2811.c 119..619 1..501 2490 99.8 Plus
CG2811.a 662 CG2811.a 20..412 1..393 1950 99.7 Plus
CG2811.c 810 CG2811.c 620..770 553..703 755 100 Plus
CG2811.a 662 CG2811.a 511..661 553..703 755 100 Plus
CG2811.a 662 CG2811.a 413..510 404..501 490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20826026..20826418 393..1 1935 99.5 Minus
chr2R 21145070 chr2R 20825660..20825967 701..394 1540 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24940072..24940464 393..1 1950 99.7 Minus
2R 25286936 2R 24939704..24940013 703..394 1550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24941271..24941663 393..1 1950 99.7 Minus
2R 25260384 2R 24940903..24941212 703..394 1550 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:34:38 has no hits.

RE67445.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:35:29 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20825660..20825967 394..701 100 <- Minus
chr2R 20826026..20826418 1..393 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:32 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 1..474 71..544 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:15 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 1..474 71..544 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:21:27 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 1..474 71..544 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:52 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 1..474 71..544 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:52:19 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 1..474 71..544 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:02 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 7..707 1..701 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:15 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 7..707 1..701 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:21:27 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 20..720 1..701 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:53 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 7..707 1..701 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:52:19 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
CG2811-RA 20..720 1..701 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:29 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24939706..24940013 394..701 100 <- Minus
2R 24940072..24940464 1..393 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:29 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24939706..24940013 394..701 100 <- Minus
2R 24940072..24940464 1..393 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:29 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24939706..24940013 394..701 100 <- Minus
2R 24940072..24940464 1..393 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:21:27 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20827595..20827987 1..393 99   Minus
arm_2R 20827229..20827536 394..701 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:01 Download gff for RE67445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24940923..24941230 394..701 100 <- Minus
2R 24941289..24941681 1..393 99   Minus

RE67445.hyp Sequence

Translation from 0 to 543

> RE67445.hyp
AIYRSDLIARYRLKLISLAAGSAMAEKLRMAARVFVYGTLKRGEPNHHWL
TKKENGQARFLGRGKTETKFPLVVGTRYNIPFLLARPGEGNHIEGEVYEV
DETMLSKLDILEDYPDYYDREQQTILMEQNETIQCWLYLIRNFPDKMLAK
ELLISYHNTPERPYNEKSVRTVSARDDLSY*

RE67445.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG2811-PA 157 CG2811-PA 1..157 24..180 835 100 Plus
CG2811-PB 157 CG2811-PB 1..143 24..166 768 100 Plus
CG2811-PC 151 CG2811-PC 1..137 30..166 740 100 Plus
Tina-1-PA 167 CG2803-PA 4..163 25..180 336 43.8 Plus
Tina-1-PB 84 CG2803-PB 1..80 104..180 139 38.8 Plus

RE67445.pep Sequence

Translation from 70 to 543

> RE67445.pep
MAEKLRMAARVFVYGTLKRGEPNHHWLTKKENGQARFLGRGKTETKFPLV
VGTRYNIPFLLARPGEGNHIEGEVYEVDETMLSKLDILEDYPDYYDREQQ
TILMEQNETIQCWLYLIRNFPDKMLAKELLISYHNTPERPYNEKSVRTVS
ARDDLSY*

RE67445.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11525-PA 153 GF11525-PA 1..153 7..157 672 80.4 Plus
Dana\GF11524-PA 167 GF11524-PA 12..163 9..157 354 46.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19876-PA 157 GG19876-PA 1..154 1..156 756 91 Plus
Dere\GG19875-PA 167 GG19875-PA 4..163 2..157 338 43.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22049-PA 156 GH22049-PA 2..156 5..157 577 66.5 Plus
Dgri\GH22048-PA 167 GH22048-PA 1..163 1..157 347 44.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG2811-PA 157 CG2811-PA 1..157 1..157 835 100 Plus
CG2811-PB 157 CG2811-PB 1..143 1..143 768 100 Plus
CG2811-PC 151 CG2811-PC 1..137 7..143 740 100 Plus
Tina-1-PA 167 CG2803-PA 4..163 2..157 336 43.8 Plus
Tina-1-PB 84 CG2803-PB 1..80 81..157 139 38.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19135-PA 156 GI19135-PA 1..156 1..157 577 66.7 Plus
Dmoj\GI19134-PA 168 GI19134-PA 12..163 9..157 350 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10896-PA 153 GL10896-PA 1..153 7..157 625 75.8 Plus
Dper\GL10895-PA 167 GL10895-PA 12..163 9..157 361 47.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15469-PA 153 GA15469-PA 1..153 7..157 619 75.2 Plus
Dpse\GA15466-PA 167 GA15466-PA 12..163 9..157 361 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11777-PA 157 GM11777-PA 1..154 1..156 762 92.9 Plus
Dsec\GM11776-PA 167 GM11776-PA 4..163 2..157 340 43.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24907-PA 157 GD24907-PA 1..154 1..156 770 93.6 Plus
Dsim\GD24906-PA 167 GD24906-PA 4..163 2..157 339 43.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22268-PA 156 GJ22268-PA 1..156 1..157 583 66.7 Plus
Dvir\GJ22267-PA 168 GJ22267-PA 12..163 9..157 351 46.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20731-PA 157 GK20731-PA 1..153 1..155 546 64.5 Plus
Dwil\GK20729-PA 168 GK20729-PA 12..163 9..157 358 47.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11400-PA 157 GE11400-PA 1..157 1..157 821 96.8 Plus
Dyak\GE11399-PA 167 GE11399-PA 4..163 2..157 340 43.8 Plus