Clone RE67583 Report

Search the DGRC for RE67583

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:675
Well:83
Vector:pFlc-1
Associated Gene/TranscriptNLaz-RA
Protein status:RE67583.pep: gold
Preliminary Size:1218
Sequenced Size:930

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16933 2002-01-01 Sim4 clustering to Release 2
CG33126 2002-02-27 Blastp of sequenced clone
CG33126 2003-01-01 Sim4 clustering to Release 3
NLaz 2008-04-29 Release 5.5 accounting
NLaz 2008-08-15 Release 5.9 accounting
NLaz 2008-12-18 5.12 accounting

Clone Sequence Records

RE67583.complete Sequence

930 bp (930 high quality bases) assembled on 2002-02-27

GenBank Submission: AY084185

> RE67583.complete
CCTCAGTTCTAAGCCAGAAGTAGAACGGATACCAAGTTCAGTGGATAGCG
ACCGTATCTCCCAGTATATTCCAGAATGAATCATCACTCGAGTTCGCACC
TGTTGCTGCTTATCTCCGTGGTATTTGGGGCAGTATGGGTGGCCCATGCC
CAGGTGCCATTTCCTGGCAAGTGCCCAGATGTTAAGCTACTGGACACCTT
CGACGCGGAAGCGTATATGGGCGTCTGGTACGAGTACGCAGCCTATCCAT
TTGCTTTCGAGATCGGCAAGAAGTGCATCTACGCCAACTACAGTCTCATA
GACAACAGCACTGTTTCGGTGGTGAATGCGGCCATCAATCGATTCACCGG
ACAACCCTCGAATGTAACTGGACAGGCCAAGGTCCTTGGACCCGGTCAAT
TGGCCGTGGCCTTTTACCCGACGCAGCCATTGACGAAGGCCAACTACCTG
GTTTTGGGCACAGATTACGAGTCATACGCCGTCGTCTACAGCTGCACCAG
TGTAACACCTTTGGCCAATTTCAAAATTGTTTGGATCTTGACTCGTCAGC
GTGAACCTTCAGCGGAAGCGGTTGATGCGGCCAGAAAGATCTTGGAAGAC
AACGATGTATCCCAGGCCTTCCTCATCGATACTGTTCAGAAGAACTGTCC
CCGGTTGGATGGTAATGGCACTGGGCTGGCCGGAGAGGATGGCCTCGATG
TGGATGACTTCGTGTCTACCACGGTGCCAAATGCCATTGAAAAGGCATGA
GAATGGCTCCGACGCCTCTACGAGCGTCTCTACGACATTTTTATGAACTT
CCTAAGTTACTAAGTGTCATGTTATCACAGAGGTCGTATTTCAGATGCTA
AATGTTCTTTGGTGCTTCAATTTAAGTTTGTTGTTATTGCGAGGAATAAA
TAAATAGAAAACCGAAAAAAAAAAAAAAAA

RE67583.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
NLaz-RA 1155 NLaz-RA 95..1009 1..915 4575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1359842..1360232 914..524 1850 98.2 Minus
chr2L 23010047 chr2L 1360655..1360786 344..213 660 100 Minus
chr2L 23010047 chr2L 1361317..1361439 213..91 615 100 Minus
chr2L 23010047 chr2L 1360351..1360449 523..425 495 100 Minus
chr2L 23010047 chr2L 1361500..1361591 92..1 460 100 Minus
chr2L 23010047 chr2L 1360516..1360595 424..345 400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1359982..1360373 915..524 1960 100 Minus
2L 23513712 2L 1360796..1360927 344..213 660 100 Minus
2L 23513712 2L 1361458..1361580 213..91 615 100 Minus
2L 23513712 2L 1360492..1360590 523..425 495 100 Minus
2L 23513712 2L 1361641..1361732 92..1 460 100 Minus
2L 23513712 2L 1360657..1360736 424..345 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1359982..1360373 915..524 1960 100 Minus
2L 23513712 2L 1360796..1360927 344..213 660 100 Minus
2L 23513712 2L 1361458..1361580 213..91 615 100 Minus
2L 23513712 2L 1360492..1360590 523..425 495 100 Minus
2L 23513712 2L 1361641..1361732 92..1 460 100 Minus
2L 23513712 2L 1360657..1360736 424..345 400 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:46:47 has no hits.

RE67583.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:47:44 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1360351..1360449 425..523 100 <- Minus
chr2L 1360516..1360595 345..424 100 <- Minus
chr2L 1360655..1360785 214..344 100 <- Minus
chr2L 1361317..1361437 93..213 100 <- Minus
chr2L 1361500..1361591 1..92 100   Minus
chr2L 1359842..1360232 524..914 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:43 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RA 1..675 76..750 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:31:41 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RA 1..675 76..750 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:55:38 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RB 1..738 76..813 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:05:24 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RA 1..675 76..750 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:55:06 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RB 1..738 76..813 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:58:28 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RA 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:31:41 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RA 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:55:38 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RA 4..917 1..914 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:05:24 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RA 1..914 1..914 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:55:06 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
NLaz-RA 4..917 1..914 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:44 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1359983..1360373 524..914 100 <- Minus
2L 1360492..1360590 425..523 100 <- Minus
2L 1360657..1360736 345..424 100 <- Minus
2L 1360796..1360926 214..344 100 <- Minus
2L 1361458..1361578 93..213 100 <- Minus
2L 1361641..1361732 1..92 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:44 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1359983..1360373 524..914 100 <- Minus
2L 1360492..1360590 425..523 100 <- Minus
2L 1360657..1360736 345..424 100 <- Minus
2L 1360796..1360926 214..344 100 <- Minus
2L 1361458..1361578 93..213 100 <- Minus
2L 1361641..1361732 1..92 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:44 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1359983..1360373 524..914 100 <- Minus
2L 1360492..1360590 425..523 100 <- Minus
2L 1360657..1360736 345..424 100 <- Minus
2L 1360796..1360926 214..344 100 <- Minus
2L 1361458..1361578 93..213 100 <- Minus
2L 1361641..1361732 1..92 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:55:38 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1359983..1360373 524..914 100 <- Minus
arm_2L 1360492..1360590 425..523 100 <- Minus
arm_2L 1360657..1360736 345..424 100 <- Minus
arm_2L 1360796..1360926 214..344 100 <- Minus
arm_2L 1361458..1361578 93..213 100 <- Minus
arm_2L 1361641..1361732 1..92 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:37 Download gff for RE67583.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1359983..1360373 524..914 100 <- Minus
2L 1360492..1360590 425..523 100 <- Minus
2L 1360657..1360736 345..424 100 <- Minus
2L 1360796..1360926 214..344 100 <- Minus
2L 1361458..1361578 93..213 100 <- Minus
2L 1361641..1361732 1..92 100   Minus

RE67583.pep Sequence

Translation from 75 to 749

> RE67583.pep
MNHHSSSHLLLLISVVFGAVWVAHAQVPFPGKCPDVKLLDTFDAEAYMGV
WYEYAAYPFAFEIGKKCIYANYSLIDNSTVSVVNAAINRFTGQPSNVTGQ
AKVLGPGQLAVAFYPTQPLTKANYLVLGTDYESYAVVYSCTSVTPLANFK
IVWILTRQREPSAEAVDAARKILEDNDVSQAFLIDTVQKNCPRLDGNGTG
LAGEDGLDVDDFVSTTVPNAIEKA*

RE67583.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14723-PA 225 GF14723-PA 1..225 1..224 850 73 Plus
Dana\GF11979-PA 213 GF11979-PA 11..210 13..192 160 26.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24593-PA 217 GG24593-PA 1..217 1..224 1067 91.1 Plus
Dere\GG22523-PA 212 GG22523-PA 31..209 31..192 160 26.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10331-PA 242 GH10331-PA 29..242 3..224 697 60.8 Plus
Dgri\GH21588-PA 214 GH21588-PA 33..213 31..194 147 23.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
NLaz-PC 224 CG33126-PC 1..224 1..224 1170 100 Plus
NLaz-PA 224 CG33126-PA 1..224 1..224 1170 100 Plus
NLaz-PB 245 CG33126-PB 1..224 1..224 1170 100 Plus
GLaz-PF 212 CG4604-PF 31..209 31..192 153 26.3 Plus
GLaz-PE 212 CG4604-PE 31..209 31..192 153 26.3 Plus
GLaz-PD 212 CG4604-PD 31..209 31..192 153 26.3 Plus
GLaz-PC 212 CG4604-PC 31..209 31..192 153 26.3 Plus
GLaz-PB 212 CG4604-PB 31..209 31..192 153 26.3 Plus
GLaz-PA 212 CG4604-PA 31..209 31..192 153 26.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17089-PA 331 GI17089-PA 1..112 1..113 391 67.3 Plus
Dmoj\GI17089-PA 331 GI17089-PA 225..331 117..224 356 62 Plus
Dmoj\GI19559-PA 215 GI19559-PA 34..215 31..195 152 25.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14838-PA 228 GL14838-PA 2..228 1..224 812 63 Plus
Dper\GL10843-PA 216 GL10843-PA 7..215 3..194 176 25.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25349-PA 228 GA25349-PA 2..228 1..224 803 62.6 Plus
Dpse\GA22440-PA 188 GA22440-PA 1..188 39..224 696 66 Plus
Dpse\GA18293-PA 216 GA18293-PA 7..215 3..194 180 26.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16611-PA 224 GM16611-PA 1..224 1..224 1173 98.7 Plus
Dsec\GM20309-PA 212 GM20309-PA 31..209 31..192 160 26.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22910-PA 224 GD22910-PA 1..224 1..224 1188 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10789-PA 216 GJ10789-PA 1..216 1..224 759 63.4 Plus
Dvir\GJ21134-PA 214 GJ21134-PA 33..213 31..194 149 24.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14948-PA 225 GK14948-PA 1..225 1..224 751 63 Plus
Dwil\GK14949-PA 192 GK14949-PA 19..189 25..192 142 26.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15611-PA 226 GE15611-PA 4..226 2..224 1086 95.5 Plus
Dyak\GE13396-PA 340 GE13396-PA 31..209 31..192 161 26.3 Plus

RE67583.hyp Sequence

Translation from 75 to 749

> RE67583.hyp
MNHHSSSHLLLLISVVFGAVWVAHAQVPFPGKCPDVKLLDTFDAEAYMGV
WYEYAAYPFAFEIGKKCIYANYSLIDNSTVSVVNAAINRFTGQPSNVTGQ
AKVLGPGQLAVAFYPTQPLTKANYLVLGTDYESYAVVYSCTSVTPLANFK
IVWILTRQREPSAEAVDAARKILEDNDVSQAFLIDTVQKNCPRLDGNGTG
LAGEDGLDVDDFVSTTVPNAIEKA*

RE67583.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
NLaz-PC 224 CG33126-PC 1..224 1..224 1170 100 Plus
NLaz-PA 224 CG33126-PA 1..224 1..224 1170 100 Plus
NLaz-PB 245 CG33126-PB 1..224 1..224 1170 100 Plus
GLaz-PF 212 CG4604-PF 31..209 31..192 153 26.3 Plus
GLaz-PE 212 CG4604-PE 31..209 31..192 153 26.3 Plus