Clone RE67638 Report

Search the DGRC for RE67638

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:676
Well:38
Vector:pFlc-1
Associated Gene/TranscriptmRpL11-RA
Protein status:RE67638.pep: gold
Preliminary Size:591
Sequenced Size:737

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3351 2002-01-01 Sim4 clustering to Release 2
CG3351 2002-03-28 Blastp of sequenced clone
CG3351 2003-01-01 Sim4 clustering to Release 3
mRpL11 2008-04-29 Release 5.5 accounting
mRpL11 2008-08-15 Release 5.9 accounting
mRpL11 2008-12-18 5.12 accounting

Clone Sequence Records

RE67638.complete Sequence

737 bp (737 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094892

> RE67638.complete
ATTTTCGCTTTGCATAACAGTTTGAATCAATTGTTTAGTTAAAATAAATC
AATTAAAATGTCGAAGGCAGCGGGTAAGCTGAAATCGCTAAAGAAGACGG
TGGAACGTGTGACGCACACGAGCAAACTGAAGACGAATATACCTGCGGGA
ATGGCTGCTGCAGGTCCGCCATTGGGACCGATGTTGGGACAGAGAGCGAT
TAATATCGCCGCTTTCTGCAAGGACTTTAATGCCAAGACCGCGGAAATGA
AAGAGGGCGTACCGCTGCCGTGCAGAATTTCCGTAAACAGCGATCGCAGC
TACGACTTGGCCATCCACCATCCGCCGGCCACATTTTTCCTGAAGCAAGC
GGCGGGCATACAAAGGGGCACCATGACTCCTGGCAAGGAGGTTGCCGGCA
TGATCACTCTCAAGCATTTGTACGAGATTGCAGCTATTAAGATTCAGGAC
CCGCCCAATGTACTTCTTACCATGCAGCAAATGTGTGAGATGCTCATCAG
CATTGCTCGGACCTGTGGCATCAAAGTGGTCAGGGAAATAGATCCGGCGG
CCTATGGCGAGTTCCTGGAGGAGCGCAAGTTAATTGTGGAACAGCAACGG
CGCGAGTTGCAGGAGAAGCGGGAAGCAAAGATGTTGCGCACGGGCTAGAT
TTGCTTATTTGCACTGTGCTTTTAATTGTTTAAAATACATTTATACTTAA
AGCGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

RE67638.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL11-RA 813 mRpL11-RA 109..813 3..707 3525 100 Plus
CG8461-RA 889 CG8461-RA 832..889 707..650 290 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10336871..10337159 189..477 1445 100 Plus
chr3R 27901430 chr3R 10337218..10337447 476..705 1150 100 Plus
chr3R 27901430 chr3R 10336625..10336814 3..192 950 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:11:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14512115..14512403 189..477 1445 100 Plus
3R 32079331 3R 14512462..14512693 476..707 1160 100 Plus
3R 32079331 3R 14511869..14512058 3..192 950 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14252946..14253234 189..477 1445 100 Plus
3R 31820162 3R 14253293..14253524 476..707 1160 100 Plus
3R 31820162 3R 14252700..14252889 3..192 950 100 Plus
Blast to na_te.dros performed 2019-03-16 23:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 1404..1511 32..133 137 63.9 Plus
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 526..580 651..702 114 72.7 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 1104..1172 701..632 113 64.3 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1381..1467 695..610 108 59.8 Minus

RE67638.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:35:30 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10336624..10336814 1..192 99 -> Plus
chr3R 10336875..10337159 193..477 100 -> Plus
chr3R 10337220..10337447 478..705 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:47 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 1..591 58..648 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:23:15 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 1..591 58..648 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:21:30 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 1..591 58..648 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:40 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 1..591 58..648 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:52:21 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 1..591 58..648 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:50:10 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 2..704 3..705 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:23:15 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 2..704 3..705 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:21:30 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 31..734 1..705 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:41 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 2..704 3..705 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:52:21 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL11-RA 31..734 1..705 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:30 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14511868..14512058 1..192 99 -> Plus
3R 14512119..14512403 193..477 100 -> Plus
3R 14512464..14512691 478..705 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:30 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14511868..14512058 1..192 99 -> Plus
3R 14512119..14512403 193..477 100 -> Plus
3R 14512464..14512691 478..705 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:30 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14511868..14512058 1..192 99 -> Plus
3R 14512119..14512403 193..477 100 -> Plus
3R 14512464..14512691 478..705 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:21:30 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10337590..10337780 1..192 99 -> Plus
arm_3R 10337841..10338125 193..477 100 -> Plus
arm_3R 10338186..10338413 478..705 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:32:33 Download gff for RE67638.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14252950..14253234 193..477 100 -> Plus
3R 14253295..14253522 478..705 100   Plus
3R 14252699..14252889 1..192 99 -> Plus

RE67638.pep Sequence

Translation from 57 to 647

> RE67638.pep
MSKAAGKLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINI
AAFCKDFNAKTAEMKEGVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAG
IQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNVLLTMQQMCEMLISIA
RTCGIKVVREIDPAAYGEFLEERKLIVEQQRRELQEKREAKMLRTG*

RE67638.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17510-PA 196 GF17510-PA 1..196 1..196 1015 96.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16856-PA 196 GG16856-PA 1..196 1..196 1020 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13965-PA 196 GH13965-PA 1..196 1..196 955 90.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL11-PA 196 CG3351-PA 1..196 1..196 996 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24842-PA 196 GI24842-PA 1..196 1..196 967 91.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23859-PA 196 GL23859-PA 1..196 1..196 1006 96.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17398-PA 196 GA17398-PA 1..196 1..196 1006 96.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24166-PA 196 GM24166-PA 1..196 1..196 1032 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18962-PA 196 GD18962-PA 1..196 1..196 984 95.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24486-PA 196 GJ24486-PA 1..196 1..196 979 92.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10947-PA 196 GK10947-PA 1..196 1..196 950 88.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24237-PA 196 GE24237-PA 1..196 1..196 1025 98.5 Plus

RE67638.hyp Sequence

Translation from 57 to 647

> RE67638.hyp
MSKAAGKLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINI
AAFCKDFNAKTAEMKEGVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAG
IQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNVLLTMQQMCEMLISIA
RTCGIKVVREIDPAAYGEFLEERKLIVEQQRRELQEKREAKMLRTG*

RE67638.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL11-PA 196 CG3351-PA 1..196 1..196 996 100 Plus