BDGP Sequence Production Resources |
Search the DGRC for RE67638
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 676 |
Well: | 38 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL11-RA |
Protein status: | RE67638.pep: gold |
Preliminary Size: | 591 |
Sequenced Size: | 737 |
Gene | Date | Evidence |
---|---|---|
CG3351 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3351 | 2002-03-28 | Blastp of sequenced clone |
CG3351 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL11 | 2008-04-29 | Release 5.5 accounting |
mRpL11 | 2008-08-15 | Release 5.9 accounting |
mRpL11 | 2008-12-18 | 5.12 accounting |
737 bp (737 high quality bases) assembled on 2002-03-28
GenBank Submission: AY094892
> RE67638.complete ATTTTCGCTTTGCATAACAGTTTGAATCAATTGTTTAGTTAAAATAAATC AATTAAAATGTCGAAGGCAGCGGGTAAGCTGAAATCGCTAAAGAAGACGG TGGAACGTGTGACGCACACGAGCAAACTGAAGACGAATATACCTGCGGGA ATGGCTGCTGCAGGTCCGCCATTGGGACCGATGTTGGGACAGAGAGCGAT TAATATCGCCGCTTTCTGCAAGGACTTTAATGCCAAGACCGCGGAAATGA AAGAGGGCGTACCGCTGCCGTGCAGAATTTCCGTAAACAGCGATCGCAGC TACGACTTGGCCATCCACCATCCGCCGGCCACATTTTTCCTGAAGCAAGC GGCGGGCATACAAAGGGGCACCATGACTCCTGGCAAGGAGGTTGCCGGCA TGATCACTCTCAAGCATTTGTACGAGATTGCAGCTATTAAGATTCAGGAC CCGCCCAATGTACTTCTTACCATGCAGCAAATGTGTGAGATGCTCATCAG CATTGCTCGGACCTGTGGCATCAAAGTGGTCAGGGAAATAGATCCGGCGG CCTATGGCGAGTTCCTGGAGGAGCGCAAGTTAATTGTGGAACAGCAACGG CGCGAGTTGCAGGAGAAGCGGGAAGCAAAGATGTTGCGCACGGGCTAGAT TTGCTTATTTGCACTGTGCTTTTAATTGTTTAAAATACATTTATACTTAA AGCGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 10336871..10337159 | 189..477 | 1445 | 100 | Plus |
chr3R | 27901430 | chr3R | 10337218..10337447 | 476..705 | 1150 | 100 | Plus |
chr3R | 27901430 | chr3R | 10336625..10336814 | 3..192 | 950 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 14512115..14512403 | 189..477 | 1445 | 100 | Plus |
3R | 32079331 | 3R | 14512462..14512693 | 476..707 | 1160 | 100 | Plus |
3R | 32079331 | 3R | 14511869..14512058 | 3..192 | 950 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 14252946..14253234 | 189..477 | 1445 | 100 | Plus |
3R | 31820162 | 3R | 14253293..14253524 | 476..707 | 1160 | 100 | Plus |
3R | 31820162 | 3R | 14252700..14252889 | 3..192 | 950 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Bari1 | 1728 | Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). | 1404..1511 | 32..133 | 137 | 63.9 | Plus |
Dbuz\INE-1 | 1467 | Dbuz\INE-1 ISBU1 1467bp | 526..580 | 651..702 | 114 | 72.7 | Plus |
ZAM | 8435 | ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). | 1104..1172 | 701..632 | 113 | 64.3 | Minus |
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 1381..1467 | 695..610 | 108 | 59.8 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 10336624..10336814 | 1..192 | 99 | -> | Plus |
chr3R | 10336875..10337159 | 193..477 | 100 | -> | Plus |
chr3R | 10337220..10337447 | 478..705 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 1..591 | 58..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 1..591 | 58..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 1..591 | 58..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 1..591 | 58..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 1..591 | 58..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 2..704 | 3..705 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 2..704 | 3..705 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 31..734 | 1..705 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 2..704 | 3..705 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL11-RA | 31..734 | 1..705 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14511868..14512058 | 1..192 | 99 | -> | Plus |
3R | 14512119..14512403 | 193..477 | 100 | -> | Plus |
3R | 14512464..14512691 | 478..705 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14511868..14512058 | 1..192 | 99 | -> | Plus |
3R | 14512119..14512403 | 193..477 | 100 | -> | Plus |
3R | 14512464..14512691 | 478..705 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14511868..14512058 | 1..192 | 99 | -> | Plus |
3R | 14512119..14512403 | 193..477 | 100 | -> | Plus |
3R | 14512464..14512691 | 478..705 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 10337590..10337780 | 1..192 | 99 | -> | Plus |
arm_3R | 10337841..10338125 | 193..477 | 100 | -> | Plus |
arm_3R | 10338186..10338413 | 478..705 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14252950..14253234 | 193..477 | 100 | -> | Plus |
3R | 14253295..14253522 | 478..705 | 100 | Plus | |
3R | 14252699..14252889 | 1..192 | 99 | -> | Plus |
Translation from 57 to 647
> RE67638.pep MSKAAGKLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINI AAFCKDFNAKTAEMKEGVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAG IQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNVLLTMQQMCEMLISIA RTCGIKVVREIDPAAYGEFLEERKLIVEQQRRELQEKREAKMLRTG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17510-PA | 196 | GF17510-PA | 1..196 | 1..196 | 1015 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16856-PA | 196 | GG16856-PA | 1..196 | 1..196 | 1020 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13965-PA | 196 | GH13965-PA | 1..196 | 1..196 | 955 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL11-PA | 196 | CG3351-PA | 1..196 | 1..196 | 996 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24842-PA | 196 | GI24842-PA | 1..196 | 1..196 | 967 | 91.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23859-PA | 196 | GL23859-PA | 1..196 | 1..196 | 1006 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17398-PA | 196 | GA17398-PA | 1..196 | 1..196 | 1006 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24166-PA | 196 | GM24166-PA | 1..196 | 1..196 | 1032 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18962-PA | 196 | GD18962-PA | 1..196 | 1..196 | 984 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24486-PA | 196 | GJ24486-PA | 1..196 | 1..196 | 979 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10947-PA | 196 | GK10947-PA | 1..196 | 1..196 | 950 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24237-PA | 196 | GE24237-PA | 1..196 | 1..196 | 1025 | 98.5 | Plus |
Translation from 57 to 647
> RE67638.hyp MSKAAGKLKSLKKTVERVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINI AAFCKDFNAKTAEMKEGVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAG IQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNVLLTMQQMCEMLISIA RTCGIKVVREIDPAAYGEFLEERKLIVEQQRRELQEKREAKMLRTG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL11-PA | 196 | CG3351-PA | 1..196 | 1..196 | 996 | 100 | Plus |