BDGP Sequence Production Resources |
Search the DGRC for RE67675
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 676 |
Well: | 75 |
Vector: | pFlc-1 |
Associated Gene/Transcript | ave-RA |
Protein status: | RE67675.pep: gold |
Sequenced Size: | 558 |
Gene | Date | Evidence |
---|---|---|
CG30476 | 2002-09-03 | Blastp of sequenced clone |
CG30476 | 2003-01-01 | Sim4 clustering to Release 3 |
ave | 2008-04-29 | Release 5.5 accounting |
ave | 2008-08-15 | Release 5.9 accounting |
ave | 2008-12-18 | 5.12 accounting |
558 bp (558 high quality bases) assembled on 2002-09-03
GenBank Submission: BT001710
> RE67675.complete ATCACTATTTGTTTTGTTGCTATTTGCAAATAAATCTTAAATTTCTCGAT TTGTTTTTTGTGAAATGGGTGAAGAAACTATTAACTCAACGCAAAACAAA ACCAGAACGAAAACTACGCGACCGAAGGCAGTGTACCTGTGGACAGTTAG CGATGTGCTCAAGTGGTATCGCCGCCACTGCGGTGAATACACCCAGTATG AGCAGCTCTTCGCCCAGCACGATATAACCGGAAGGGCTCTACTCCGGATC ACAGACTCCTCACTGCAAAGAATGGGCGTGACGGACAACCGGGATCGGGA AGCCATTTGGCGGGAGATCGTTAAGCAGCGACTGAAGACGGATATCATGG AAATCCGGGATATGGAAAGGCTCAATATTTACTAGGGTCACGATATACTC GTTTTATTTGCTGTAATAGGAGAATAGTTAATGCGTATTTTGTAAACTTT CTTTTTAAGATTCTTAGACGCCATATCTGGTTTTAGATTAGACAATCATG TATGCTATTAATCAAATATATAAGAGCGCAAAATTCTAGATGAAAAAAAA AAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ave-RA | 650 | ave-RA | 68..612 | 1..545 | 2710 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Bari1 | 1728 | Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). | 312..374 | 466..403 | 110 | 65.6 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 10639812..10640028 | 1..217 | 100 | -> | Plus |
chr2R | 10640232..10640555 | 218..542 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 1..321 | 65..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 1..321 | 65..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 1..321 | 65..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 1..321 | 65..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 1..321 | 65..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 1..541 | 1..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 1..541 | 1..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 6..546 | 1..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 1..541 | 1..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ave-RA | 6..546 | 1..541 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14752526..14752742 | 1..217 | 100 | -> | Plus |
2R | 14752946..14753269 | 218..542 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14752526..14752742 | 1..217 | 100 | -> | Plus |
2R | 14752946..14753269 | 218..542 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14752526..14752742 | 1..217 | 100 | -> | Plus |
2R | 14752946..14753269 | 218..542 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 10640031..10640247 | 1..217 | 100 | -> | Plus |
arm_2R | 10640451..10640774 | 218..542 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14753725..14753941 | 1..217 | 100 | -> | Plus |
2R | 14754145..14754468 | 218..542 | 99 | Plus |
Translation from 64 to 384
> RE67675.pep MGEETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHCGEYTQYEQLFA QHDITGRALLRITDSSLQRMGVTDNRDREAIWREIVKQRLKTDIMEIRDM ERLNIY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11340-PA | 106 | GF11340-PA | 1..106 | 1..106 | 536 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20478-PA | 106 | GG20478-PA | 1..106 | 1..106 | 558 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20753-PA | 106 | GH20753-PA | 1..106 | 1..106 | 488 | 87.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ave-PA | 106 | CG30476-PA | 1..106 | 1..106 | 557 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20838-PA | 106 | GI20838-PA | 1..106 | 1..106 | 473 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11459-PA | 107 | GL11459-PA | 3..106 | 2..105 | 519 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15868-PA | 107 | GA15868-PA | 3..106 | 2..105 | 519 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21568-PA | 106 | GM21568-PA | 1..106 | 1..106 | 552 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11074-PA | 106 | GD11074-PA | 1..106 | 1..106 | 558 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20573-PA | 106 | GJ20573-PA | 1..106 | 1..106 | 471 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19633-PA | 105 | GK19633-PA | 1..105 | 1..105 | 503 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13608-PA | 106 | GE13608-PA | 1..106 | 1..106 | 554 | 99.1 | Plus |
Translation from 64 to 384
> RE67675.hyp MGEETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHCGEYTQYEQLFA QHDITGRALLRITDSSLQRMGVTDNRDREAIWREIVKQRLKTDIMEIRDM ERLNIY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ave-PA | 106 | CG30476-PA | 1..106 | 1..106 | 557 | 100 | Plus |