Clone RE67675 Report

Search the DGRC for RE67675

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:676
Well:75
Vector:pFlc-1
Associated Gene/Transcriptave-RA
Protein status:RE67675.pep: gold
Sequenced Size:558

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30476 2002-09-03 Blastp of sequenced clone
CG30476 2003-01-01 Sim4 clustering to Release 3
ave 2008-04-29 Release 5.5 accounting
ave 2008-08-15 Release 5.9 accounting
ave 2008-12-18 5.12 accounting

Clone Sequence Records

RE67675.complete Sequence

558 bp (558 high quality bases) assembled on 2002-09-03

GenBank Submission: BT001710

> RE67675.complete
ATCACTATTTGTTTTGTTGCTATTTGCAAATAAATCTTAAATTTCTCGAT
TTGTTTTTTGTGAAATGGGTGAAGAAACTATTAACTCAACGCAAAACAAA
ACCAGAACGAAAACTACGCGACCGAAGGCAGTGTACCTGTGGACAGTTAG
CGATGTGCTCAAGTGGTATCGCCGCCACTGCGGTGAATACACCCAGTATG
AGCAGCTCTTCGCCCAGCACGATATAACCGGAAGGGCTCTACTCCGGATC
ACAGACTCCTCACTGCAAAGAATGGGCGTGACGGACAACCGGGATCGGGA
AGCCATTTGGCGGGAGATCGTTAAGCAGCGACTGAAGACGGATATCATGG
AAATCCGGGATATGGAAAGGCTCAATATTTACTAGGGTCACGATATACTC
GTTTTATTTGCTGTAATAGGAGAATAGTTAATGCGTATTTTGTAAACTTT
CTTTTTAAGATTCTTAGACGCCATATCTGGTTTTAGATTAGACAATCATG
TATGCTATTAATCAAATATATAAGAGCGCAAAATTCTAGATGAAAAAAAA
AAAAAAAA

RE67675.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
ave-RA 650 ave-RA 68..612 1..545 2710 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10640229..10640555 215..541 1635 100 Plus
chr2R 21145070 chr2R 10639812..10640028 1..217 1085 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14752943..14753273 215..545 1640 99.7 Plus
2R 25286936 2R 14752526..14752742 1..217 1085 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14754142..14754472 215..545 1640 99.6 Plus
2R 25260384 2R 14753725..14753941 1..217 1085 100 Plus
Blast to na_te.dros performed 2019-03-16 21:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 312..374 466..403 110 65.6 Minus

RE67675.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:22:07 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10639812..10640028 1..217 100 -> Plus
chr2R 10640232..10640555 218..542 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:48 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..321 65..385 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:01:02 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..321 65..385 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:38:01 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..321 65..385 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:42:07 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..321 65..385 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:17:44 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..321 65..385 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:02:34 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..541 1..541 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:01:02 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..541 1..541 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:01 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 6..546 1..541 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:42:07 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..541 1..541 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:17:44 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 6..546 1..541 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:22:07 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14752526..14752742 1..217 100 -> Plus
2R 14752946..14753269 218..542 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:22:07 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14752526..14752742 1..217 100 -> Plus
2R 14752946..14753269 218..542 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:22:07 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14752526..14752742 1..217 100 -> Plus
2R 14752946..14753269 218..542 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:01 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10640031..10640247 1..217 100 -> Plus
arm_2R 10640451..10640774 218..542 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:26:35 Download gff for RE67675.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14753725..14753941 1..217 100 -> Plus
2R 14754145..14754468 218..542 99   Plus

RE67675.pep Sequence

Translation from 64 to 384

> RE67675.pep
MGEETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHCGEYTQYEQLFA
QHDITGRALLRITDSSLQRMGVTDNRDREAIWREIVKQRLKTDIMEIRDM
ERLNIY*

RE67675.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11340-PA 106 GF11340-PA 1..106 1..106 536 95.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20478-PA 106 GG20478-PA 1..106 1..106 558 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20753-PA 106 GH20753-PA 1..106 1..106 488 87.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
ave-PA 106 CG30476-PA 1..106 1..106 557 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20838-PA 106 GI20838-PA 1..106 1..106 473 84 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11459-PA 107 GL11459-PA 3..106 2..105 519 94.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15868-PA 107 GA15868-PA 3..106 2..105 519 94.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21568-PA 106 GM21568-PA 1..106 1..106 552 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11074-PA 106 GD11074-PA 1..106 1..106 558 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20573-PA 106 GJ20573-PA 1..106 1..106 471 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19633-PA 105 GK19633-PA 1..105 1..105 503 90.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13608-PA 106 GE13608-PA 1..106 1..106 554 99.1 Plus

RE67675.hyp Sequence

Translation from 64 to 384

> RE67675.hyp
MGEETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHCGEYTQYEQLFA
QHDITGRALLRITDSSLQRMGVTDNRDREAIWREIVKQRLKTDIMEIRDM
ERLNIY*

RE67675.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
ave-PA 106 CG30476-PA 1..106 1..106 557 100 Plus