Clone RE67710 Report

Search the DGRC for RE67710

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:677
Well:10
Vector:pFlc-1
Associated Gene/TranscriptCG31460-RA
Protein status:RE67710.pep: gold
Sequenced Size:553

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31460 2002-09-03 Blastp of sequenced clone
CG31460 2003-01-01 Sim4 clustering to Release 3
CG31460 2008-04-29 Release 5.5 accounting
CG31460 2008-08-15 Release 5.9 accounting
CG31460 2008-12-18 5.12 accounting

Clone Sequence Records

RE67710.complete Sequence

553 bp (553 high quality bases) assembled on 2002-09-03

GenBank Submission: BT001712

> RE67710.complete
AAGAAAGACGCCGGCTGGAAGAAAAAGTAATATGTCCGCTTCAGTGAGCA
GTAAGAGCACCGTGGTATCCTCCATCATCTCGGGCCTCCTGAGCATTGTT
TTGTTCGGCACACTGCGTTTCTGCTCAGAATGGTTTAACGACTCGCAGCT
GAGGGTCCTTTTGGGCGGATACCTCTTCTCCTGGGTGTTCATCCTGAGCC
TCACGTGCGTCTCCAACGCGGAGATGGTTGTTTTCGGCCAGGACTTCCAG
GCCAAGCTGCTACCAGAGATTATTTTCTGTCTCTCACTCACGGTGGCCGC
CGCGGGACTCGTGCATCGTGTCTGCGCCACCACCAGTGTTCTCTTTTCCC
TGGTGGGGCTCTACTTCCTTAACAGGATCTCCACGAAGTATTACTCCGTT
CAGGTGCCCAGCGTGGATGCTCCTACGACGAGAAAGGGCGGAAAGAAGTT
CAAATGAACCATTAGTCTGCTTCTTATTTCATTACTAACACATTCGAATA
CCTAATCTTTAATAGCCTTTAATAAATAACTAACTTATAAAAAAAAAAAA
AAA

RE67710.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31460.a 805 CG31460.a 180..720 1..541 2675 99.6 Plus
CG31460-RA 832 CG31460-RA 180..720 1..541 2675 99.6 Plus
CG31460.b 1061 CG31460.b 180..720 1..541 2675 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4388957..4389459 36..538 2455 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8562943..8563448 36..541 2500 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8303774..8304279 36..541 2500 99.6 Plus
3R 31820162 3R 8303683..8303717 1..35 175 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:28:11 has no hits.

RE67710.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:29:04 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4388866..4388900 1..35 100 -> Plus
chr3R 4388957..4389459 36..538 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:50 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 1..426 32..457 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:11:07 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 1..426 32..457 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:13:40 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 1..426 32..457 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:42:09 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 1..426 32..457 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:22:14 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 1..426 32..457 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:02:37 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 1..538 1..538 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:11:07 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 1..538 1..538 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:40 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 17..554 1..538 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:42:10 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 1..538 1..538 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:22:14 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
CG31460-RA 17..554 1..538 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:04 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8562852..8562886 1..35 100 -> Plus
3R 8562943..8563445 36..538 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:04 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8562852..8562886 1..35 100 -> Plus
3R 8562943..8563445 36..538 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:04 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8562852..8562886 1..35 100 -> Plus
3R 8562943..8563445 36..538 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:40 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4388574..4388608 1..35 100 -> Plus
arm_3R 4388665..4389167 36..538 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:19:45 Download gff for RE67710.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8303683..8303717 1..35 100 -> Plus
3R 8303774..8304276 36..538 99   Plus

RE67710.hyp Sequence

Translation from 0 to 456

> RE67710.hyp
RKTPAGRKSNMSASVSSKSTVVSSIISGLLSIVLFGTLRFCSEWFNDSQL
RVLLGGYLFSWVFILSLTCVSNAEMVVFGQDFQAKLLPEIIFCLSLTVAA
AGLVHRVCATTSVLFSLVGLYFLNRISTKYYSVQVPSVDAPTTRKGGKKF
K*

RE67710.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG31460-PB 141 CG31460-PB 1..141 11..151 705 100 Plus
CG31460-PA 141 CG31460-PA 1..141 11..151 705 100 Plus

RE67710.pep Sequence

Translation from 31 to 456

> RE67710.pep
MSASVSSKSTVVSSIISGLLSIVLFGTLRFCSEWFNDSQLRVLLGGYLFS
WVFILSLTCVSNAEMVVFGQDFQAKLLPEIIFCLSLTVAAAGLVHRVCAT
TSVLFSLVGLYFLNRISTKYYSVQVPSVDAPTTRKGGKKFK*

RE67710.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20762-PA 140 GF20762-PA 1..140 1..141 592 80.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16487-PA 137 GG16487-PA 1..137 5..141 668 94.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17374-PA 138 GH17374-PA 1..138 3..141 497 73.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31460-PB 141 CG31460-PB 1..141 1..141 705 100 Plus
CG31460-PA 141 CG31460-PA 1..141 1..141 705 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23918-PA 137 GI23918-PA 1..137 4..141 486 67.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22290-PA 140 GL22290-PA 1..140 1..141 578 79.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16263-PA 140 GA16263-PA 1..140 1..141 576 78.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23741-PA 141 GM23741-PA 1..141 1..141 704 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18549-PA 137 GD18549-PA 1..137 5..141 685 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24011-PA 76 GJ24011-PA 1..76 65..141 288 71.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11592-PA 140 GK11592-PA 1..140 1..141 568 75.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25884-PA 137 GE25884-PA 1..137 5..141 681 94.9 Plus