BDGP Sequence Production Resources |
Search the DGRC for RE67710
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 677 |
Well: | 10 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG31460-RA |
Protein status: | RE67710.pep: gold |
Sequenced Size: | 553 |
Gene | Date | Evidence |
---|---|---|
CG31460 | 2002-09-03 | Blastp of sequenced clone |
CG31460 | 2003-01-01 | Sim4 clustering to Release 3 |
CG31460 | 2008-04-29 | Release 5.5 accounting |
CG31460 | 2008-08-15 | Release 5.9 accounting |
CG31460 | 2008-12-18 | 5.12 accounting |
553 bp (553 high quality bases) assembled on 2002-09-03
GenBank Submission: BT001712
> RE67710.complete AAGAAAGACGCCGGCTGGAAGAAAAAGTAATATGTCCGCTTCAGTGAGCA GTAAGAGCACCGTGGTATCCTCCATCATCTCGGGCCTCCTGAGCATTGTT TTGTTCGGCACACTGCGTTTCTGCTCAGAATGGTTTAACGACTCGCAGCT GAGGGTCCTTTTGGGCGGATACCTCTTCTCCTGGGTGTTCATCCTGAGCC TCACGTGCGTCTCCAACGCGGAGATGGTTGTTTTCGGCCAGGACTTCCAG GCCAAGCTGCTACCAGAGATTATTTTCTGTCTCTCACTCACGGTGGCCGC CGCGGGACTCGTGCATCGTGTCTGCGCCACCACCAGTGTTCTCTTTTCCC TGGTGGGGCTCTACTTCCTTAACAGGATCTCCACGAAGTATTACTCCGTT CAGGTGCCCAGCGTGGATGCTCCTACGACGAGAAAGGGCGGAAAGAAGTT CAAATGAACCATTAGTCTGCTTCTTATTTCATTACTAACACATTCGAATA CCTAATCTTTAATAGCCTTTAATAAATAACTAACTTATAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 4388957..4389459 | 36..538 | 2455 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 8562943..8563448 | 36..541 | 2500 | 99.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 4388866..4388900 | 1..35 | 100 | -> | Plus |
chr3R | 4388957..4389459 | 36..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 1..426 | 32..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 1..426 | 32..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 1..426 | 32..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 1..426 | 32..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 1..426 | 32..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 1..538 | 1..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 1..538 | 1..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 17..554 | 1..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 1..538 | 1..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31460-RA | 17..554 | 1..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8562852..8562886 | 1..35 | 100 | -> | Plus |
3R | 8562943..8563445 | 36..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8562852..8562886 | 1..35 | 100 | -> | Plus |
3R | 8562943..8563445 | 36..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8562852..8562886 | 1..35 | 100 | -> | Plus |
3R | 8562943..8563445 | 36..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 4388574..4388608 | 1..35 | 100 | -> | Plus |
arm_3R | 4388665..4389167 | 36..538 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8303683..8303717 | 1..35 | 100 | -> | Plus |
3R | 8303774..8304276 | 36..538 | 99 | Plus |
Translation from 0 to 456
> RE67710.hyp RKTPAGRKSNMSASVSSKSTVVSSIISGLLSIVLFGTLRFCSEWFNDSQL RVLLGGYLFSWVFILSLTCVSNAEMVVFGQDFQAKLLPEIIFCLSLTVAA AGLVHRVCATTSVLFSLVGLYFLNRISTKYYSVQVPSVDAPTTRKGGKKF K*
Translation from 31 to 456
> RE67710.pep MSASVSSKSTVVSSIISGLLSIVLFGTLRFCSEWFNDSQLRVLLGGYLFS WVFILSLTCVSNAEMVVFGQDFQAKLLPEIIFCLSLTVAAAGLVHRVCAT TSVLFSLVGLYFLNRISTKYYSVQVPSVDAPTTRKGGKKFK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20762-PA | 140 | GF20762-PA | 1..140 | 1..141 | 592 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16487-PA | 137 | GG16487-PA | 1..137 | 5..141 | 668 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17374-PA | 138 | GH17374-PA | 1..138 | 3..141 | 497 | 73.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31460-PB | 141 | CG31460-PB | 1..141 | 1..141 | 705 | 100 | Plus |
CG31460-PA | 141 | CG31460-PA | 1..141 | 1..141 | 705 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23918-PA | 137 | GI23918-PA | 1..137 | 4..141 | 486 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22290-PA | 140 | GL22290-PA | 1..140 | 1..141 | 578 | 79.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16263-PA | 140 | GA16263-PA | 1..140 | 1..141 | 576 | 78.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23741-PA | 141 | GM23741-PA | 1..141 | 1..141 | 704 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18549-PA | 137 | GD18549-PA | 1..137 | 5..141 | 685 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24011-PA | 76 | GJ24011-PA | 1..76 | 65..141 | 288 | 71.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11592-PA | 140 | GK11592-PA | 1..140 | 1..141 | 568 | 75.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25884-PA | 137 | GE25884-PA | 1..137 | 5..141 | 681 | 94.9 | Plus |