Clone RE67729 Report

Search the DGRC for RE67729

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:677
Well:29
Vector:pFlc-1
Associated Gene/TranscriptCG12607-RB
Protein status:RE67729.pep: gold
Preliminary Size:474
Sequenced Size:703

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12607 2002-01-01 Sim4 clustering to Release 2
CG12607 2002-01-09 Blastp of sequenced clone
CG12607 2003-01-01 Sim4 clustering to Release 3
CG12607 2008-04-29 Release 5.5 accounting
CG12607 2008-08-15 Release 5.9 accounting
CG12607 2008-12-18 5.12 accounting

Clone Sequence Records

RE67729.complete Sequence

703 bp (703 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075517

> RE67729.complete
AGCTCATCATCATTTGTGCTTTGAACTTCTTAAGTGTAAATTGCTCGTTT
GCTTCTGCTCGAGAAAATTTCGTGAAACCCCAAAACCAAAACAAACAAAA
ATGAAATTCTTTTTGCTATTGGCTTTGGCCCTTGTGGGCATTGCTGCTGG
AGCTCAGCTTCCTGACTCCGCCACCCAGGGACCCAATCCTCAGGATATTG
CCACCCCGGAGCCGGAGTACATTGATATCGACGAACCTGCACCGGTGGCT
GCCGCACCTGCTCCTCGTCCTGTGGCCGCTGCTCCCCGTCCCGTCTTCGC
CGCCCCTGCTCCCATCGCTCGGCCAGTTGCTCATCCAGTGGCTCGCCCCG
TGGTTGTGGCCCAATCCTTCGTCCAGCAGCCCGTCCAGCAGCAGATTGTC
CAGAGGGCTCAGTACGTGGCGCCGGTGGCTCAGCAGGTGGTGTTGCCGCA
ACAGCAGCTGGTGGGACACACCTACAACAGCAGGGCTGGATACCAGTACC
GCCGTCCAGTCTATAACGAAACCATCAAAGAAACGACCAACAAGAAGAAG
TCAAGATCAAAAGCATAAAGAGCGAAGTACAAAGAGACAAATGATGTTCT
AAAGACAAAGATCGAAAAACGAAGTATTCAGTTATTGTTGAATTGCCCAG
TAAAGTACGAATAAATAAACGTAAATTATTTGTAAATAAAAAAAAAAAAA
AAA

RE67729.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-RB 852 CG12607-RB 104..789 1..686 3430 100 Plus
CG12607.c 955 CG12607.c 104..617 1..514 2570 100 Plus
CG12607.b 1162 CG12607.b 104..617 1..514 2570 100 Plus
CG12607.c 955 CG12607.c 717..892 511..686 865 99.4 Plus
CG12607.b 1162 CG12607.b 924..1099 511..686 865 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4446565..4446976 103..514 2060 100 Plus
chr3L 24539361 chr3L 4447283..4447458 511..686 865 99.4 Plus
chr3L 24539361 chr3L 4445963..4446065 1..103 515 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4447176..4447587 103..514 2060 100 Plus
3L 28110227 3L 4447894..4448069 511..686 865 99.4 Plus
3L 28110227 3L 4446575..4446677 1..103 515 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4447176..4447587 103..514 2060 100 Plus
3L 28103327 3L 4447894..4448069 511..686 865 99.4 Plus
3L 28103327 3L 4446575..4446677 1..103 515 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:38:05 has no hits.

RE67729.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:39:08 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4447287..4447458 515..687 99   Plus
chr3L 4446566..4446976 104..514 100 -> Plus
chr3L 4445963..4446065 1..103 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:52 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 1..468 101..568 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:17:39 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 1..468 101..568 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:06:14 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 1..468 101..568 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:08:49 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 1..468 101..568 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:00 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 1..468 101..568 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:42:08 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 1..681 1..681 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:17:39 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 1..681 1..681 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:06:14 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 3..688 1..687 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:08:49 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 1..681 1..681 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:00 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RB 3..688 1..687 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:08 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4446575..4446677 1..103 100 -> Plus
3L 4447177..4447587 104..514 100 -> Plus
3L 4447898..4448069 515..687 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:08 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4446575..4446677 1..103 100 -> Plus
3L 4447177..4447587 104..514 100 -> Plus
3L 4447898..4448069 515..687 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:08 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4446575..4446677 1..103 100 -> Plus
3L 4447177..4447587 104..514 100 -> Plus
3L 4447898..4448069 515..687 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:06:14 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4447177..4447587 104..514 100 -> Plus
arm_3L 4447898..4448069 515..687 99   Plus
arm_3L 4446575..4446677 1..103 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:40:50 Download gff for RE67729.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4447177..4447587 104..514 100 -> Plus
3L 4447898..4448069 515..687 99   Plus
3L 4446575..4446677 1..103 100 -> Plus

RE67729.hyp Sequence

Translation from 0 to 567

> RE67729.hyp
AHHHLCFELLKCKLLVCFCSRKFRETPKPKQTKMKFFLLLALALVGIAAG
AQLPDSATQGPNPQDIATPEPEYIDIDEPAPVAAAPAPRPVAAAPRPVFA
APAPIARPVAHPVARPVVVAQSFVQQPVQQQIVQRAQYVAPVAQQVVLPQ
QQLVGHTYNSRAGYQYRRPVYNETIKETTNKKKSRSKA*

RE67729.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-PB 155 CG12607-PB 1..155 34..188 787 100 Plus
CG12607-PD 139 CG12607-PD 1..139 34..172 705 99.3 Plus
CG12607-PC 148 CG12607-PC 1..138 34..171 704 100 Plus

RE67729.pep Sequence

Translation from 100 to 567

> RE67729.pep
MKFFLLLALALVGIAAGAQLPDSATQGPNPQDIATPEPEYIDIDEPAPVA
AAPAPRPVAAAPRPVFAAPAPIARPVAHPVARPVVVAQSFVQQPVQQQIV
QRAQYVAPVAQQVVLPQQQLVGHTYNSRAGYQYRRPVYNETIKETTNKKK
SRSKA*

RE67729.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25074-PA 145 GF25074-PA 1..145 2..155 281 77.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15231-PA 154 GG15231-PA 1..154 1..155 479 86.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-PB 155 CG12607-PB 1..155 1..155 787 100 Plus
CG12607-PD 139 CG12607-PD 1..139 1..139 705 99.3 Plus
CG12607-PC 148 CG12607-PC 1..138 1..138 704 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12730-PA 145 GI12730-PA 1..133 1..136 285 52.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11716-PA 148 GA11716-PA 1..138 1..138 309 65.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14662-PA 155 GM14662-PA 1..155 1..155 417 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13846-PA 164 GD13846-PA 21..164 12..155 413 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15502-PA 138 GJ15502-PA 1..128 1..138 313 60.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16585-PA 146 GK16585-PA 1..136 1..138 250 66.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21450-PA 153 GE21450-PA 1..153 1..155 395 89.2 Plus