RE67729.complete Sequence
703 bp (703 high quality bases) assembled on 2002-01-09
GenBank Submission: AY075517
> RE67729.complete
AGCTCATCATCATTTGTGCTTTGAACTTCTTAAGTGTAAATTGCTCGTTT
GCTTCTGCTCGAGAAAATTTCGTGAAACCCCAAAACCAAAACAAACAAAA
ATGAAATTCTTTTTGCTATTGGCTTTGGCCCTTGTGGGCATTGCTGCTGG
AGCTCAGCTTCCTGACTCCGCCACCCAGGGACCCAATCCTCAGGATATTG
CCACCCCGGAGCCGGAGTACATTGATATCGACGAACCTGCACCGGTGGCT
GCCGCACCTGCTCCTCGTCCTGTGGCCGCTGCTCCCCGTCCCGTCTTCGC
CGCCCCTGCTCCCATCGCTCGGCCAGTTGCTCATCCAGTGGCTCGCCCCG
TGGTTGTGGCCCAATCCTTCGTCCAGCAGCCCGTCCAGCAGCAGATTGTC
CAGAGGGCTCAGTACGTGGCGCCGGTGGCTCAGCAGGTGGTGTTGCCGCA
ACAGCAGCTGGTGGGACACACCTACAACAGCAGGGCTGGATACCAGTACC
GCCGTCCAGTCTATAACGAAACCATCAAAGAAACGACCAACAAGAAGAAG
TCAAGATCAAAAGCATAAAGAGCGAAGTACAAAGAGACAAATGATGTTCT
AAAGACAAAGATCGAAAAACGAAGTATTCAGTTATTGTTGAATTGCCCAG
TAAAGTACGAATAAATAAACGTAAATTATTTGTAAATAAAAAAAAAAAAA
AAA
RE67729.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:43:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12607-RB | 852 | CG12607-RB | 104..789 | 1..686 | 3430 | 100 | Plus |
CG12607.c | 955 | CG12607.c | 104..617 | 1..514 | 2570 | 100 | Plus |
CG12607.b | 1162 | CG12607.b | 104..617 | 1..514 | 2570 | 100 | Plus |
CG12607.c | 955 | CG12607.c | 717..892 | 511..686 | 865 | 99.4 | Plus |
CG12607.b | 1162 | CG12607.b | 924..1099 | 511..686 | 865 | 99.4 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:38:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 4446565..4446976 | 103..514 | 2060 | 100 | Plus |
chr3L | 24539361 | chr3L | 4447283..4447458 | 511..686 | 865 | 99.4 | Plus |
chr3L | 24539361 | chr3L | 4445963..4446065 | 1..103 | 515 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:38:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 4447176..4447587 | 103..514 | 2060 | 100 | Plus |
3L | 28110227 | 3L | 4447894..4448069 | 511..686 | 865 | 99.4 | Plus |
3L | 28110227 | 3L | 4446575..4446677 | 1..103 | 515 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:17:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 4447176..4447587 | 103..514 | 2060 | 100 | Plus |
3L | 28103327 | 3L | 4447894..4448069 | 511..686 | 865 | 99.4 | Plus |
3L | 28103327 | 3L | 4446575..4446677 | 1..103 | 515 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 16:38:05 has no hits.
RE67729.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:39:08 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 4447287..4447458 | 515..687 | 99 | | Plus |
chr3L | 4446566..4446976 | 104..514 | 100 | -> | Plus |
chr3L | 4445963..4446065 | 1..103 | 100 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:32:52 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 1..468 | 101..568 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:17:39 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 1..468 | 101..568 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:06:14 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 1..468 | 101..568 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:08:49 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 1..468 | 101..568 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:00 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 1..468 | 101..568 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:42:08 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 1..681 | 1..681 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:17:39 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 1..681 | 1..681 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:06:14 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 3..688 | 1..687 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:08:49 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 1..681 | 1..681 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:00 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12607-RB | 3..688 | 1..687 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:08 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4446575..4446677 | 1..103 | 100 | -> | Plus |
3L | 4447177..4447587 | 104..514 | 100 | -> | Plus |
3L | 4447898..4448069 | 515..687 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:08 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4446575..4446677 | 1..103 | 100 | -> | Plus |
3L | 4447177..4447587 | 104..514 | 100 | -> | Plus |
3L | 4447898..4448069 | 515..687 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:08 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4446575..4446677 | 1..103 | 100 | -> | Plus |
3L | 4447177..4447587 | 104..514 | 100 | -> | Plus |
3L | 4447898..4448069 | 515..687 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:06:14 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 4447177..4447587 | 104..514 | 100 | -> | Plus |
arm_3L | 4447898..4448069 | 515..687 | 99 | | Plus |
arm_3L | 4446575..4446677 | 1..103 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:40:50 Download gff for
RE67729.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4447177..4447587 | 104..514 | 100 | -> | Plus |
3L | 4447898..4448069 | 515..687 | 99 | | Plus |
3L | 4446575..4446677 | 1..103 | 100 | -> | Plus |
RE67729.hyp Sequence
Translation from 0 to 567
> RE67729.hyp
AHHHLCFELLKCKLLVCFCSRKFRETPKPKQTKMKFFLLLALALVGIAAG
AQLPDSATQGPNPQDIATPEPEYIDIDEPAPVAAAPAPRPVAAAPRPVFA
APAPIARPVAHPVARPVVVAQSFVQQPVQQQIVQRAQYVAPVAQQVVLPQ
QQLVGHTYNSRAGYQYRRPVYNETIKETTNKKKSRSKA*
RE67729.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12607-PB | 155 | CG12607-PB | 1..155 | 34..188 | 787 | 100 | Plus |
CG12607-PD | 139 | CG12607-PD | 1..139 | 34..172 | 705 | 99.3 | Plus |
CG12607-PC | 148 | CG12607-PC | 1..138 | 34..171 | 704 | 100 | Plus |
RE67729.pep Sequence
Translation from 100 to 567
> RE67729.pep
MKFFLLLALALVGIAAGAQLPDSATQGPNPQDIATPEPEYIDIDEPAPVA
AAPAPRPVAAAPRPVFAAPAPIARPVAHPVARPVVVAQSFVQQPVQQQIV
QRAQYVAPVAQQVVLPQQQLVGHTYNSRAGYQYRRPVYNETIKETTNKKK
SRSKA*
RE67729.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:42:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF25074-PA | 145 | GF25074-PA | 1..145 | 2..155 | 281 | 77.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:42:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15231-PA | 154 | GG15231-PA | 1..154 | 1..155 | 479 | 86.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12607-PB | 155 | CG12607-PB | 1..155 | 1..155 | 787 | 100 | Plus |
CG12607-PD | 139 | CG12607-PD | 1..139 | 1..139 | 705 | 99.3 | Plus |
CG12607-PC | 148 | CG12607-PC | 1..138 | 1..138 | 704 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:42:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI12730-PA | 145 | GI12730-PA | 1..133 | 1..136 | 285 | 52.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:42:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA11716-PA | 148 | GA11716-PA | 1..138 | 1..138 | 309 | 65.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:42:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14662-PA | 155 | GM14662-PA | 1..155 | 1..155 | 417 | 96.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:42:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13846-PA | 164 | GD13846-PA | 21..164 | 12..155 | 413 | 95.8 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:42:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ15502-PA | 138 | GJ15502-PA | 1..128 | 1..138 | 313 | 60.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:42:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK16585-PA | 146 | GK16585-PA | 1..136 | 1..138 | 250 | 66.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:42:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21450-PA | 153 | GE21450-PA | 1..153 | 1..155 | 395 | 89.2 | Plus |