Clone RE67916 Report

Search the DGRC for RE67916

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:679
Well:16
Vector:pFlc-1
Associated Gene/TranscriptObp83cd-RA
Protein status:RE67916.pep: gold
Preliminary Size:690
Sequenced Size:916

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15582 2001-12-14 Blastp of sequenced clone
CG15582 2002-01-01 Sim4 clustering to Release 2
CG15582 2003-01-01 Sim4 clustering to Release 3
Obp83cd 2008-04-29 Release 5.5 accounting
Obp83cd 2008-08-15 Release 5.9 accounting
Obp83cd 2008-12-18 5.12 accounting

Clone Sequence Records

RE67916.complete Sequence

916 bp (916 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071635

> RE67916.complete
AATCAAGCAAAGAACGTGCAGGAAACTACTAGAATATTGAGAATTGTTTA
GCAATGCAGATGAAAAGTGGAATATTAATAGCATTATGTCTATGCCTTTC
GTTGAACGAAGGCCTGGCCCTTCTGGAGCACGAAGGCGAGACCATCAACA
GATGCATCCAAAACTATGGCGGACTTACTGCGGAAAATGCCGAACGTCTA
GAACGATTCAAGGAATGGTCGGATAGCTACGAGGAAATCCCCTGCTTCAC
GCGCTGCTATTTGTCCGAGATGTTCGACTTTTACAATAACTTAACGGGCT
TCAATAAGGACGGAATTGTGGGCGTCTTTGGAAGACCCGTCTACGAAGCC
TGCCGAAAGAAATTGGAACTGCCATTCGAATCAGGCGAGAGCAGCTGCAA
ACATGCCTACGAGGGCTTCCACTGCATCACCAACATGGAAAGCCACCCGT
TCACGGTTATTGACAACATGCCAAACATATCCCCGTCGGCCAAGGATGCA
ATGAAGGACTGCCTTCAGGATGTCCACCAGGACGAGTGGAAGAGCTTCGA
TGCCTTCGCCTACTATCCTGTCAATGAACCGATTCCGTGCTTCACCCGGT
GCTTCGTGGACAAGCTGCATATCTTCGAGGAGAAAACGCGTCTTTGGAAA
CTGGAGGCGATGAAGCAAAACCTGGGCATTCCGGCCAAAGGAGCTCGCAT
AAGGACCTGCCATCGGCACCGCGGCAGGGACCGATGTGCCACATATTACA
AACAGTTCACCTGCTACGCGATGGCTGTTTAGGCAGCTATTATTGTAAGC
AAAATTTATAAATGATTACATACTAATTTAATGATAAAAGTATGCTTTCA
TTTGTCTAGATAATATTTCCGAATTTTGAAATATATAGATCTTACAATGC
GAAAAAAAAAAAAAAA

RE67916.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Obp83cd-RA 1080 Obp83cd-RA 148..1046 1..899 4495 100 Plus
Obp83ef-RA 1024 Obp83ef-RA 841..1024 899..716 920 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1934909..1935373 435..899 2310 99.8 Plus
chr3R 27901430 chr3R 1933940..1934270 104..434 1655 100 Plus
chr3R 27901430 chr3R 1933774..1933877 1..104 520 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6109269..6109733 435..899 2325 100 Plus
3R 32079331 3R 6108300..6108630 104..434 1655 100 Plus
3R 32079331 3R 6108134..6108237 1..104 520 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5850100..5850564 435..899 2325 100 Plus
3R 31820162 3R 5849131..5849461 104..434 1655 100 Plus
3R 31820162 3R 5848965..5849068 1..104 520 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:34:59 has no hits.

RE67916.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:35:40 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1933941..1934270 105..434 100 -> Plus
chr3R 1934909..1935375 435..901 99   Plus
chr3R 1933774..1933877 1..104 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:33:02 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..729 54..782 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:53 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..729 54..782 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:21:37 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..729 54..782 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:29 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..729 54..782 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:52:40 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..729 54..782 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:28 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..901 1..901 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:53 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..901 1..901 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:21:37 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..899 1..899 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:29 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..901 1..901 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:52:40 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
Obp83cd-RA 1..899 1..899 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:40 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6108134..6108237 1..104 100 -> Plus
3R 6108301..6108630 105..434 100 -> Plus
3R 6109269..6109735 435..901 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:40 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6108134..6108237 1..104 100 -> Plus
3R 6108301..6108630 105..434 100 -> Plus
3R 6109269..6109735 435..901 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:35:40 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6108134..6108237 1..104 100 -> Plus
3R 6108301..6108630 105..434 100 -> Plus
3R 6109269..6109735 435..901 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:21:37 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1933856..1933959 1..104 100 -> Plus
arm_3R 1934023..1934352 105..434 100 -> Plus
arm_3R 1934991..1935457 435..901 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:29 Download gff for RE67916.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5849132..5849461 105..434 100 -> Plus
3R 5850100..5850566 435..901 99   Plus
3R 5848965..5849068 1..104 100 -> Plus

RE67916.pep Sequence

Translation from 53 to 781

> RE67916.pep
MQMKSGILIALCLCLSLNEGLALLEHEGETINRCIQNYGGLTAENAERLE
RFKEWSDSYEEIPCFTRCYLSEMFDFYNNLTGFNKDGIVGVFGRPVYEAC
RKKLELPFESGESSCKHAYEGFHCITNMESHPFTVIDNMPNISPSAKDAM
KDCLQDVHQDEWKSFDAFAYYPVNEPIPCFTRCFVDKLHIFEEKTRLWKL
EAMKQNLGIPAKGARIRTCHRHRGRDRCATYYKQFTCYAMAV*

RE67916.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16368-PA 246 GF16368-PA 17..239 19..241 827 64.1 Plus
Dana\GF18628-PA 247 GF18628-PA 19..231 21..238 178 23.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13108-PA 242 GG13108-PA 1..241 1..241 1114 84.6 Plus
Dere\GG10589-PA 247 GG10589-PA 1..229 3..238 205 24.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14012-PA 244 GH14012-PA 5..243 8..242 651 47.5 Plus
Dgri\GH14286-PA 226 GH14286-PA 3..213 22..238 155 22.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Obp83cd-PA 242 CG15582-PA 1..242 1..242 1334 100 Plus
Obp83ef-PA 245 CG31557-PA 1..230 3..238 200 24.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24045-PA 242 GL24045-PA 8..242 8..242 861 62.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp83cd-PA 242 GA13828-PA 8..242 8..242 874 63.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10854-PA 242 GM10854-PA 1..242 1..242 1232 92.6 Plus
Dsec\GM10568-PA 243 GM10568-PA 1..230 3..238 196 23.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp83cd-PA 242 GD19836-PA 1..242 1..242 1251 94.6 Plus
Dsim\Obp83ef-PA 243 GD19560-PA 1..230 3..238 204 24.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp83cd-PA 239 GJ14238-PA 4..239 7..242 761 55.5 Plus
Dvir\Obp83ef-PA 223 GJ14494-PA 2..210 21..238 160 22.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13025-PA 207 GK13025-PA 1..206 35..241 594 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10179-PA 242 GE10179-PA 1..242 1..242 1167 88 Plus
Dyak\GE24116-PA 246 GE24116-PA 1..230 3..238 211 25.2 Plus

RE67916.hyp Sequence

Translation from 53 to 781

> RE67916.hyp
MQMKSGILIALCLCLSLNEGLALLEHEGETINRCIQNYGGLTAENAERLE
RFKEWSDSYEEIPCFTRCYLSEMFDFYNNLTGFNKDGIVGVFGRPVYEAC
RKKLELPFESGESSCKHAYEGFHCITNMESHPFTVIDNMPNISPSAKDAM
KDCLQDVHQDEWKSFDAFAYYPVNEPIPCFTRCFVDKLHIFEEKTRLWKL
EAMKQNLGIPAKGARIRTCHRHRGRDRCATYYKQFTCYAMAV*

RE67916.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Obp83cd-PA 242 CG15582-PA 1..242 1..242 1334 100 Plus
Obp83ef-PA 245 CG31557-PA 1..230 3..238 200 24.2 Plus