Clone RE67940 Report

Search the DGRC for RE67940

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:679
Well:40
Vector:pFlc-1
Associated Gene/TranscriptCG31251-RA
Protein status:RE67940.pep: gold
Sequenced Size:1072

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31251 2003-01-01 Sim4 clustering to Release 3
CG31251 2008-04-29 Release 5.5 accounting
CG31251 2008-08-15 Release 5.9 accounting
CG31251 2008-12-18 5.12 accounting

Clone Sequence Records

RE67940.complete Sequence

1072 bp (1072 high quality bases) assembled on 2005-08-04

GenBank Submission: BT023804

> RE67940.complete
AGTGTTATTGATAGACGTGAACATTAGATGTTAAGTTAAAAGCGGCCGGT
TACTATTCTTACAAAAATGGACTTTCAGCGAAACGATGCTATGCTCATGG
AAATTCTGCAGGATCGGAAAACTATTACAGGTTTCCTGGACTCCATTTTC
GGATTTCTGCGACGCAACACCGACTTTTATCACACAAAACGCGATGAAGC
GGATAAAATAGGCTTCCCCAAAGGCGTGAGGGATCAGATTCTATATGGCG
CCATGCAGCGCTACGATCCGGATTGCTTGCTACAATCCCTGACCGCGGAA
GGCGGTGCAGATGATGGAGAAACGGCTCCGCCTGCCGTCGAAGAAGTGGT
CCTGGAAAGCGAAGATGGTCCTCAGGACGAGGAAATGAAACCCATAGAGA
GCCAGCCGCCACAAAAAGGGAAGGAGCAGTCAAAGTTCTCCCCCAGCGAC
TACAAAAACGGAGATGTGTTCGAAACGCACTGCTGGTCACAAACCCTCAA
GGATGTGGAGGTGCAGGCTCTGCTTCCCAAGGATCATCAAACGGCGAAGA
AGCTGCACATTTCAATTCAGGCCCAGCACATCAAAGTGAGCAGCAAGCAT
AGCCCAGAGACGATCATCCTCGAGGGAAACCTGAGCCAGCGGATTAAACA
CAAGGAGGCGGTGTGGACAATTGATCAGAACCGATTGATCATAAGTTACG
ATAAAGCAAAGGAGCTCTGGTGGGATCGGCTCTTCGAAGGTGATCCAGAA
ATCGATTCCAAGAAGATTGAATGCGAACGCTATATAGATGATTTGCCGGA
GGAAACCCAGGCCACCATAGAAAAGCTTAGGGTCCAGCAGTTGGCAGCAG
ACAAGCAACAAAATGAAATTCAGACCTCAAGTCCCGACCAAGCTATAAAC
CTGGATCGCCTGAAAGCTGCCTGGGATGCCGAAGGTTCGCCGTTTAAAGG
ACAGCCCTTTGATCCTTCTATCGTAAGAATGAGTTAAATTTTAAAATAAT
TAATTAAGCTAGCAATAGTAGTAAAATAGTAAAAACTGAACCATATATAT
TTTTATAAAAAAAAAAAAAAAA

RE67940.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG31251-RA 1122 CG31251-RA 69..1122 3..1056 5255 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13508499..13509028 697..168 2650 100 Minus
chr3R 27901430 chr3R 13508083..13508437 1054..700 1730 99.2 Minus
chr3R 27901430 chr3R 13509086..13509250 167..3 810 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17684155..17684687 700..168 2665 100 Minus
3R 32079331 3R 17683739..17684096 1057..700 1790 100 Minus
3R 32079331 3R 17684745..17684909 167..3 810 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17424986..17425518 700..168 2665 100 Minus
3R 31820162 3R 17424570..17424927 1057..700 1790 100 Minus
3R 31820162 3R 17425576..17425740 167..3 810 99.3 Minus
Blast to na_te.dros performed on 2019-03-16 04:07:38 has no hits.

RE67940.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:08:34 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13508079..13508436 701..1056 92 <- Minus
chr3R 13508496..13509028 168..700 99 <- Minus
chr3R 13509086..13509252 1..167 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:33:04 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 1..921 67..987 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:55:38 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 1..921 67..987 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:17:38 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 1..921 67..987 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:36:19 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 1..921 67..987 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:27:43 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 1..921 67..987 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:32:19 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 1..987 1..987 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:55:38 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 1..1056 1..1056 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:17:38 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 5..1060 1..1056 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:36:19 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 1..987 1..987 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:27:43 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
CG31251-RA 5..1060 1..1056 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:34 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17684745..17684911 1..167 98   Minus
3R 17683740..17684095 701..1056 100 <- Minus
3R 17684155..17684687 168..700 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:34 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17684745..17684911 1..167 98   Minus
3R 17683740..17684095 701..1056 100 <- Minus
3R 17684155..17684687 168..700 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:34 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17684745..17684911 1..167 98   Minus
3R 17683740..17684095 701..1056 100 <- Minus
3R 17684155..17684687 168..700 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:17:38 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13509462..13509817 701..1056 100 <- Minus
arm_3R 13509877..13510409 168..700 100 <- Minus
arm_3R 13510467..13510633 1..167 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:14:55 Download gff for RE67940.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17424571..17424926 701..1056 100 <- Minus
3R 17424986..17425518 168..700 100 <- Minus
3R 17425576..17425742 1..167 98   Minus

RE67940.pep Sequence

Translation from 66 to 986

> RE67940.pep
MDFQRNDAMLMEILQDRKTITGFLDSIFGFLRRNTDFYHTKRDEADKIGF
PKGVRDQILYGAMQRYDPDCLLQSLTAEGGADDGETAPPAVEEVVLESED
GPQDEEMKPIESQPPQKGKEQSKFSPSDYKNGDVFETHCWSQTLKDVEVQ
ALLPKDHQTAKKLHISIQAQHIKVSSKHSPETIILEGNLSQRIKHKEAVW
TIDQNRLIISYDKAKELWWDRLFEGDPEIDSKKIECERYIDDLPEETQAT
IEKLRVQQLAADKQQNEIQTSSPDQAINLDRLKAAWDAEGSPFKGQPFDP
SIVRMS*

RE67940.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17174-PA 303 GF17174-PA 1..303 1..306 1196 73 Plus
Dana\GF23933-PA 332 GF23933-PA 143..295 108..258 170 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16760-PA 306 GG16760-PA 1..306 1..306 1464 88.9 Plus
Dere\GG13580-PA 332 GG13580-PA 138..295 103..258 167 32.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16573-PA 299 GH16573-PA 1..299 1..306 997 62.5 Plus
Dgri\GH16226-PA 334 GH16226-PA 7..297 4..258 170 28.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG31251-PA 306 CG31251-PA 1..306 1..306 1607 100 Plus
nudC-PB 332 CG9710-PB 26..295 23..258 194 27.4 Plus
nudC-PA 332 CG9710-PA 26..295 23..258 194 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13864-PA 305 GI13864-PA 1..305 1..306 1074 66 Plus
Dmoj\GI13372-PA 334 GI13372-PA 20..297 17..258 162 28 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21703-PA 297 GL21703-PA 1..297 1..306 1121 68.5 Plus
Dper\GL16069-PA 336 GL16069-PA 147..299 108..258 178 34.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26376-PA 294 GA26376-PA 1..294 1..306 1134 69.6 Plus
Dpse\GA21982-PA 336 GA21982-PA 147..299 108..258 178 34.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15349-PA 306 GM15349-PA 1..306 1..306 1546 94.1 Plus
Dsec\GM25659-PA 332 GM25659-PA 143..295 108..258 183 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15097-PA 298 GD15097-PA 1..298 9..306 1524 95.3 Plus
Dsim\GD14666-PA 332 GD14666-PA 143..295 108..258 184 35.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11725-PA 304 GJ11725-PA 1..304 1..306 1053 65.4 Plus
Dvir\GJ13202-PA 334 GJ13202-PA 7..297 4..258 167 25.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13789-PA 297 GK13789-PA 5..297 2..306 968 61.2 Plus
Dwil\GK23802-PA 324 GK23802-PA 23..288 20..258 189 26.8 Plus
Dwil\GK12498-PA 326 GK12498-PA 7..289 4..258 173 26.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25255-PA 306 GE25255-PA 1..306 1..306 1447 88.6 Plus
Dyak\GE19876-PA 332 GE19876-PA 138..295 103..258 169 32.9 Plus

RE67940.hyp Sequence

Translation from 66 to 986

> RE67940.hyp
MDFQRNDAMLMEILQDRKTITGFLDSIFGFLRRNTDFYHTKRDEADKIGF
PKGVRDQILYGAMQRYDPDCLLQSLTAEGGADDGETAPPAVEEVVLESED
GPQDEEMKPIESQPPQKGKEQSKFSPSDYKNGDVFETHCWSQTLKDVEVQ
ALLPKDHQTAKKLHISIQAQHIKVSSKHSPETIILEGNLSQRIKHKEAVW
TIDQNRLIISYDKAKELWWDRLFEGDPEIDSKKIECERYIDDLPEETQAT
IEKLRVQQLAADKQQNEIQTSSPDQAINLDRLKAAWDAEGSPFKGQPFDP
SIVRMS*

RE67940.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG31251-PA 306 CG31251-PA 1..306 1..306 1607 100 Plus
nudC-PB 332 CG9710-PB 26..295 23..258 194 27.4 Plus
nudC-PA 332 CG9710-PA 26..295 23..258 194 27.4 Plus