Clone RE68036 Report

Search the DGRC for RE68036

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:680
Well:36
Vector:pFlc-1
Associated Gene/TranscriptCG14615-RA
Protein status:RE68036.pep: gold
Preliminary Size:1139
Sequenced Size:1254

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14615 2001-12-14 Blastp of sequenced clone
CG14615 2002-01-01 Sim4 clustering to Release 2
CG14615 2003-01-01 Sim4 clustering to Release 3
CG14615 2008-04-29 Release 5.5 accounting
CG14615 2008-08-15 Release 5.9 accounting
CG14615 2008-12-18 5.12 accounting

Clone Sequence Records

RE68036.complete Sequence

1254 bp (1254 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071636

> RE68036.complete
AAGTAGTTTAACTAGCGAATTAACAGCGACGCATTTACTGCGGCCAGCTC
TCTAGTCTTTTAGCAGCGGGCAGGCGGAAGGTTCACAAAAACTAAATTCA
AATCGAATCGGCTGACAGACAGATACATATAGACCGGCAATGAGTTCAGA
TAAGAACGGTGATATCTTGCGGCCACTTAGCGATAGCGAAGTGGACGAAC
TGCTTGATCTATACAAAGTTAAATTCGGTATAAGGAACTTCCACTACCTA
TTACTGTACAACCAGCGAAAATGGGACCGCCAGCTGAGCGAGGCTCAAAT
ACCGCGCAATGATCTGAACCACATTTCTCTGAGAAAGCAGTTCTACACCC
ATCGAAGGGGAAACTTCCGGACGTGGGGCACCTATGTGAGCCTTCATCGG
GACATCGTGCAGAGCGTCTCCTTCTTCAGCTGGCAGCCAGATGGAGCCGC
GGAGCTGTGGGAATGCCTGGAGCAAACGCAGCTCATCGAGTGGACACAGG
GAGCCCTGCTGACCAACGTTGATCTGGGATTTTGTAATCGAGTCAAAGAG
TTGGCCGTCAGCCGCGGGGTCACCGCCATTCAACCACGCCAGTGTTTCGG
GATGGTTTTGTCGCACGAGGATGCCTTTTGTGCAAAAGTTCCAGATCTGC
CCTCTGAGTTCGAGATTCGGCGATTGAGGGCTGAGGATGCAGCCATGGTG
CACGATTCCTGGCCTAACAAGGGTGAAGGCTCACTCACTTATCTCCAGGC
GCTCGTCCGTTTCAACAAATCCTTGGGCATCTGCCGAAGCGACACTGGGG
AACTGATTGCCTGGATCTTTCAGAACGACTTTTCCGGACTGGGCATGCTG
CAAGTGCTGCCCAAGGCGGAGCGTAGAGGACTAGGTGGCCTCCTAGCCGC
TGCGATGAGCCGAGAAATTGCTCGGGGCGAGGAGATCACCCTAACGGCCT
GGATTGTCGCTACTAACTGGCGGTCGGAGGCGCTGCTCAAGCGGATCGGG
TACCAGAAAGATCTGGTCAATGAGTGGATTAAGCTGGTACCGAATTCTTC
ATAGACGCTCCGGTCGCCAAAGAACTGGCGACGGTGCTGGATAGTTAGAC
AACTGGTAAATAGGTGAGGTCAAGAAGAAGACGAGGCGATTTGCATTTGC
TTTGCCTATGTACATGTACATACATCAACAATTTTATTTTGGCATTTAAC
ATGCGTACACGCTTTCTGAATACACTTTACGGCTTAACGAAAAAAAAAAA
AAAA

RE68036.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14615.a 1876 CG14615.a 79..1320 1..1242 6195 99.9 Plus
CG14615-RA 1500 CG14615-RA 122..1363 1..1242 6195 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 21844498..21845340 843..1 4215 100 Minus
chrX 22417052 chrX 21843709..21844103 1237..843 1975 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 22448532..22449374 843..1 4215 100 Minus
X 23542271 X 22447738..22448137 1242..843 1985 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 22433624..22434466 843..1 4215 100 Minus
X 23527363 X 22432830..22433229 1242..843 1985 99.7 Minus
Blast to na_te.dros performed on 2019-03-15 16:38:07 has no hits.

RE68036.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:39:09 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 21843707..21844102 844..1239 99 <- Minus
chrX 21844498..21845340 1..843 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:33:09 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 1..915 140..1054 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:40 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 1..915 140..1054 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:06:16 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 1..915 140..1054 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:16 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 1..915 140..1054 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:03 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 1..915 140..1054 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:38 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 118..1353 1..1236 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:40 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 118..1353 1..1236 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:06:16 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 118..1356 1..1239 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:16 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 118..1353 1..1236 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:03 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
CG14615-RA 118..1356 1..1239 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:09 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
X 22447741..22448136 844..1239 99 <- Minus
X 22448532..22449374 1..843 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:09 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
X 22447741..22448136 844..1239 99 <- Minus
X 22448532..22449374 1..843 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:09 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
X 22447741..22448136 844..1239 99 <- Minus
X 22448532..22449374 1..843 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:06:16 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21849577..21849972 844..1239 99 <- Minus
arm_X 21850368..21851210 1..843 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:29 Download gff for RE68036.complete
Subject Subject Range Query Range Percent Splice Strand
X 22432833..22433228 844..1239 99 <- Minus
X 22433624..22434466 1..843 100   Minus

RE68036.pep Sequence

Translation from 139 to 1053

> RE68036.pep
MSSDKNGDILRPLSDSEVDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLS
EAQIPRNDLNHISLRKQFYTHRRGNFRTWGTYVSLHRDIVQSVSFFSWQP
DGAAELWECLEQTQLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPR
QCFGMVLSHEDAFCAKVPDLPSEFEIRRLRAEDAAMVHDSWPNKGEGSLT
YLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGG
LLAAAMSREIARGEEITLTAWIVATNWRSEALLKRIGYQKDLVNEWIKLV
PNSS*

RE68036.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21274-PA 305 GF21274-PA 1..304 1..304 1308 78.9 Plus
Dana\GF14492-PA 284 GF14492-PA 89..275 115..303 184 26.6 Plus
Dana\GF15332-PA 277 GF15332-PA 107..268 129..289 179 25.9 Plus
Dana\GF14490-PA 293 GF14490-PA 49..267 58..289 178 23.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17517-PA 304 GG17517-PA 1..304 1..304 1485 90.5 Plus
Dere\GG23486-PA 281 GG23486-PA 57..279 74..299 198 26.8 Plus
Dere\GG21112-PA 287 GG21112-PA 92..278 115..303 195 27.7 Plus
Dere\GG25020-PA 364 GG25020-PA 69..286 80..302 174 26 Plus
Dere\GG21109-PA 293 GG21109-PA 5..227 7..249 171 25.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17807-PA 302 GH17807-PA 1..301 1..301 1143 69.8 Plus
Dgri\GH11464-PA 279 GH11464-PA 154..271 171..290 199 34.7 Plus
Dgri\GH11202-PA 292 GH11202-PA 18..253 47..276 194 27.5 Plus
Dgri\GH11463-PA 280 GH11463-PA 7..271 6..290 194 25.7 Plus
Dgri\GH11205-PA 288 GH11205-PA 85..277 108..301 194 26.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14615-PB 304 CG14615-PB 1..304 1..304 1600 100 Plus
CG14615-PA 304 CG14615-PA 1..304 1..304 1600 100 Plus
CG17681-PA 293 CG17681-PA 5..267 7..289 216 25.1 Plus
CG12560-PB 278 CG12560-PB 152..269 170..289 194 32.2 Plus
CG5783-PA 287 CG5783-PA 92..276 115..301 193 27.5 Plus
CG12560-PC 272 CG12560-PC 46..263 55..289 190 26.2 Plus
CG15628-PB 364 CG15628-PB 69..286 80..302 154 25.3 Plus
CG15628-PA 364 CG15628-PA 69..286 80..302 154 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15150-PA 300 GI15150-PA 2..299 3..301 1173 71.2 Plus
Dmoj\GI18126-PA 285 GI18126-PA 78..274 104..301 207 29 Plus
Dmoj\GI18127-PA 287 GI18127-PA 68..276 89..301 203 24.9 Plus
Dmoj\GI16891-PA 265 GI16891-PA 140..257 171..290 185 32.2 Plus
Dmoj\GI15713-PA 416 GI15713-PA 119..336 80..302 175 26.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13430-PA 305 GL13430-PA 3..303 1..301 1242 76.7 Plus
Dper\GL18506-PA 274 GL18506-PA 88..265 113..289 199 28 Plus
Dper\GL18695-PA 293 GL18695-PA 122..266 137..288 179 30.1 Plus
Dper\GL18697-PA 287 GL18697-PA 134..278 157..303 172 29.7 Plus
Dper\GL19370-PA 338 GL19370-PA 69..286 80..302 165 25.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13114-PA 305 GA13114-PA 3..303 1..301 1237 76.4 Plus
Dpse\GA25663-PA 286 GA25663-PA 155..277 162..289 184 31.2 Plus
Dpse\GA14610-PA 293 GA14610-PA 122..266 137..288 179 30.1 Plus
Dpse\GA25939-PA 367 GA25939-PA 69..286 80..302 165 25.5 Plus
Dpse\GA19124-PA 287 GA19124-PA 134..277 157..302 162 28.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11726-PA 304 GM11726-PA 1..304 1..304 1495 91.1 Plus
Dsec\GM17267-PA 291 GM17267-PA 48..265 59..289 205 26 Plus
Dsec\GM13211-PA 277 GM13211-PA 105..275 127..296 200 27.5 Plus
Dsec\GM17269-PA 287 GM17269-PA 92..277 115..302 186 26.8 Plus
Dsec\GM18493-PA 364 GM18493-PA 69..286 80..302 171 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24428-PA 283 GD24428-PA 1..283 1..304 1348 84.5 Plus
Dsim\GD24132-PA 395 GD24132-PA 5..254 7..276 204 25.6 Plus
Dsim\GD22448-PA 278 GD22448-PA 105..276 127..296 201 27.1 Plus
Dsim\GD24134-PA 287 GD24134-PA 92..277 115..302 189 27.4 Plus
Dsim\GD23301-PA 364 GD23301-PA 69..286 80..302 162 25.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19009-PA 301 GJ19009-PA 3..300 4..301 1177 72.5 Plus
Dvir\GJ17752-PA 287 GJ17752-PA 145..276 169..301 199 33.6 Plus
Dvir\GJ17205-PA 281 GJ17205-PA 156..273 171..290 189 35.5 Plus
Dvir\GJ17751-PA 285 GJ17751-PA 89..276 114..303 187 26 Plus
Dvir\GJ17749-PA 292 GJ17749-PA 53..253 68..276 178 28.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16280-PA 302 GK16280-PA 1..302 1..303 1128 68.3 Plus
Dwil\GK15539-PA 289 GK15539-PA 7..263 10..289 200 26.7 Plus
Dwil\GK15541-PA 288 GK15541-PA 92..279 114..303 188 25.7 Plus
Dwil\GK15128-PA 339 GK15128-PA 212..328 171..289 149 29.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15272-PA 305 GE15272-PA 3..305 2..304 1452 89.1 Plus
Dyak\GE11235-PA 264 GE11235-PA 6..262 50..296 192 24.5 Plus
Dyak\GE11237-PA 278 GE11237-PA 146..269 161..289 192 29.5 Plus
Dyak\GE13184-PA 287 GE13184-PA 91..277 114..302 185 27 Plus
Dyak\GE13182-PA 293 GE13182-PA 11..267 16..289 178 26.7 Plus

RE68036.hyp Sequence

Translation from 139 to 1053

> RE68036.hyp
MSSDKNGDILRPLSDSEVDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLS
EAQIPRNDLNHISLRKQFYTHRRGNFRTWGTYVSLHRDIVQSVSFFSWQP
DGAAELWECLEQTQLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPR
QCFGMVLSHEDAFCAKVPDLPSEFEIRRLRAEDAAMVHDSWPNKGEGSLT
YLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGG
LLAAAMSREIARGEEITLTAWIVATNWRSEALLKRIGYQKDLVNEWIKLV
PNSS*

RE68036.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14615-PB 304 CG14615-PB 1..304 1..304 1600 100 Plus
CG14615-PA 304 CG14615-PA 1..304 1..304 1600 100 Plus
CG17681-PA 293 CG17681-PA 5..267 7..289 216 25.1 Plus
CG12560-PB 278 CG12560-PB 152..269 170..289 194 32.2 Plus
CG5783-PA 287 CG5783-PA 92..276 115..301 193 27.5 Plus