BDGP Sequence Production Resources |
Search the DGRC for RE68515
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 685 |
Well: | 15 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG14543-RA |
Protein status: | RE68515.pep: gold |
Sequenced Size: | 663 |
Gene | Date | Evidence |
---|---|---|
CG14543 | 2001-12-14 | Blastp of sequenced clone |
CG14543 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14543 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14543 | 2008-04-29 | Release 5.5 accounting |
CG14543 | 2008-08-15 | Release 5.9 accounting |
CG14543 | 2008-12-18 | 5.12 accounting |
663 bp (663 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071640
> RE68515.complete ATCACAAAAGCATGCGATGGCAGCCGCACAACAAACTGAATTCCAAAAGA ATTTTAGAGTGATTGTAGAGAAGATCTTCAATCACTGGCAGGATCTCCGG CTGGCGGTGGAGCATGGCATGGGCGGACGCAATGGCCAACAGGTGGCCAT AGAAATCATGGACTACACCTACCAGTACTGCGTGTCCAACGAAAATATCA CGCAAGGCGAACTGGTGGAGGTCCTGGAGGAGCTGATGGACCAGGAGTTT AACACCCTCTGCGACGACGACTCCATTCCGGAGATCTGCCGGAATCTGCT GCGCTACAAATTGATGGCCCAGCAGAACCAGTTTCCGCAAATAGAGGCTG AATTGAGTAAACTTCCTGCTGGCAAGGAGTGGCTGCGTCCGGATGTTAAG ATCACCTACACACCCATCGATGGGGACTCCTCATCCGATGAGGACATGGA CGACAGCGACGAGGAGGACGATAATGAAATGGGCCAGGGCGACGAGGAAA CTCCCAGCGGCAGTGGTCGGATGACGCGATCGCAGGCACGAAAGCAGCAG GCTGAGGAGTTTGTGGAACCGGAAGACGGCTGGACCACCGTGCGAAGAAA ATGAATTTCGTCGGGATGATTAAAAAGAAACCTGCTAGTTTTTTAGCAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14543-RA | 754 | CG14543-RA | 40..685 | 1..646 | 3230 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 21879627..21879768 | 1..142 | 100 | -> | Plus |
chr3R | 21879833..21880336 | 143..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 1..588 | 17..604 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 1..588 | 17..604 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 1..588 | 17..604 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 1..588 | 17..604 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 1..588 | 17..604 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 15..660 | 1..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 15..660 | 1..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 12..657 | 1..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 15..660 | 1..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14543-RA | 12..657 | 1..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26056641..26056782 | 1..142 | 100 | -> | Plus |
3R | 26056847..26057350 | 143..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26056641..26056782 | 1..142 | 100 | -> | Plus |
3R | 26056847..26057350 | 143..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26056641..26056782 | 1..142 | 100 | -> | Plus |
3R | 26056847..26057350 | 143..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 21882363..21882504 | 1..142 | 100 | -> | Plus |
arm_3R | 21882569..21883072 | 143..647 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25797678..25798181 | 143..647 | 99 | Plus | |
3R | 25797472..25797613 | 1..142 | 100 | -> | Plus |
Translation from 0 to 603
> RE68515.hyp SQKHAMAAAQQTEFQKNFRVIVEKIFNHWQDLRLAVEHGMGGRNGQQVAI EIMDYTYQYCVSNENITQGELVEVLEELMDQEFNTLCDDDSIPEICRNLL RYKLMAQQNQFPQIEAELSKLPAGKEWLRPDVKITYTPIDGDSSSDEDMD DSDEEDDNEMGQGDEETPSGSGRMTRSQARKQQAEEFVEPEDGWTTVRRK *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14543-PA | 195 | CG14543-PA | 1..195 | 6..200 | 1028 | 100 | Plus |
Translation from 16 to 603
> RE68515.pep MAAAQQTEFQKNFRVIVEKIFNHWQDLRLAVEHGMGGRNGQQVAIEIMDY TYQYCVSNENITQGELVEVLEELMDQEFNTLCDDDSIPEICRNLLRYKLM AQQNQFPQIEAELSKLPAGKEWLRPDVKITYTPIDGDSSSDEDMDDSDEE DDNEMGQGDEETPSGSGRMTRSQARKQQAEEFVEPEDGWTTVRRK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16806-PA | 194 | GF16806-PA | 1..194 | 1..195 | 803 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11462-PA | 195 | GG11462-PA | 1..195 | 1..195 | 1012 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19463-PA | 201 | GH19463-PA | 3..201 | 2..195 | 771 | 72.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14543-PA | 195 | CG14543-PA | 1..195 | 1..195 | 1028 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24697-PA | 194 | GI24697-PA | 3..194 | 6..195 | 748 | 79.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21826-PA | 196 | GL21826-PA | 1..196 | 1..195 | 785 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13068-PA | 197 | GA13068-PA | 1..197 | 1..195 | 784 | 80.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10304-PA | 194 | GM10304-PA | 1..194 | 1..195 | 1011 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21267-PA | 195 | GD21267-PA | 1..195 | 1..195 | 1026 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23913-PA | 199 | GJ23913-PA | 3..199 | 2..195 | 738 | 71.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14463-PA | 197 | GK14463-PA | 4..197 | 2..195 | 781 | 77.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23654-PA | 195 | GE23654-PA | 1..195 | 1..195 | 1014 | 96.9 | Plus |