Clone RE68515 Report

Search the DGRC for RE68515

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:685
Well:15
Vector:pFlc-1
Associated Gene/TranscriptCG14543-RA
Protein status:RE68515.pep: gold
Sequenced Size:663

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14543 2001-12-14 Blastp of sequenced clone
CG14543 2002-01-01 Sim4 clustering to Release 2
CG14543 2003-01-01 Sim4 clustering to Release 3
CG14543 2008-04-29 Release 5.5 accounting
CG14543 2008-08-15 Release 5.9 accounting
CG14543 2008-12-18 5.12 accounting

Clone Sequence Records

RE68515.complete Sequence

663 bp (663 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071640

> RE68515.complete
ATCACAAAAGCATGCGATGGCAGCCGCACAACAAACTGAATTCCAAAAGA
ATTTTAGAGTGATTGTAGAGAAGATCTTCAATCACTGGCAGGATCTCCGG
CTGGCGGTGGAGCATGGCATGGGCGGACGCAATGGCCAACAGGTGGCCAT
AGAAATCATGGACTACACCTACCAGTACTGCGTGTCCAACGAAAATATCA
CGCAAGGCGAACTGGTGGAGGTCCTGGAGGAGCTGATGGACCAGGAGTTT
AACACCCTCTGCGACGACGACTCCATTCCGGAGATCTGCCGGAATCTGCT
GCGCTACAAATTGATGGCCCAGCAGAACCAGTTTCCGCAAATAGAGGCTG
AATTGAGTAAACTTCCTGCTGGCAAGGAGTGGCTGCGTCCGGATGTTAAG
ATCACCTACACACCCATCGATGGGGACTCCTCATCCGATGAGGACATGGA
CGACAGCGACGAGGAGGACGATAATGAAATGGGCCAGGGCGACGAGGAAA
CTCCCAGCGGCAGTGGTCGGATGACGCGATCGCAGGCACGAAAGCAGCAG
GCTGAGGAGTTTGTGGAACCGGAAGACGGCTGGACCACCGTGCGAAGAAA
ATGAATTTCGTCGGGATGATTAAAAAGAAACCTGCTAGTTTTTTAGCAAA
AAAAAAAAAAAAA

RE68515.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG14543-RA 754 CG14543-RA 40..685 1..646 3230 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21879831..21880336 141..646 2515 99.8 Plus
chr3R 27901430 chr3R 21879627..21879770 1..144 720 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26056845..26057350 141..646 2530 100 Plus
3R 32079331 3R 26056641..26056784 1..144 720 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25797676..25798181 141..646 2530 100 Plus
3R 31820162 3R 25797472..25797615 1..144 720 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:21:21 has no hits.

RE68515.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:22:10 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21879627..21879768 1..142 100 -> Plus
chr3R 21879833..21880336 143..647 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:33:27 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 1..588 17..604 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:52 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 1..588 17..604 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:38:09 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 1..588 17..604 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:09 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 1..588 17..604 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:17:49 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 1..588 17..604 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:38:02 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 15..660 1..646 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:52 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 15..660 1..646 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:09 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 12..657 1..646 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:09 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 15..660 1..646 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:17:49 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14543-RA 12..657 1..646 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:22:10 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26056641..26056782 1..142 100 -> Plus
3R 26056847..26057350 143..647 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:22:10 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26056641..26056782 1..142 100 -> Plus
3R 26056847..26057350 143..647 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:22:10 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26056641..26056782 1..142 100 -> Plus
3R 26056847..26057350 143..647 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:09 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21882363..21882504 1..142 100 -> Plus
arm_3R 21882569..21883072 143..647 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:07 Download gff for RE68515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25797678..25798181 143..647 99   Plus
3R 25797472..25797613 1..142 100 -> Plus

RE68515.hyp Sequence

Translation from 0 to 603

> RE68515.hyp
SQKHAMAAAQQTEFQKNFRVIVEKIFNHWQDLRLAVEHGMGGRNGQQVAI
EIMDYTYQYCVSNENITQGELVEVLEELMDQEFNTLCDDDSIPEICRNLL
RYKLMAQQNQFPQIEAELSKLPAGKEWLRPDVKITYTPIDGDSSSDEDMD
DSDEEDDNEMGQGDEETPSGSGRMTRSQARKQQAEEFVEPEDGWTTVRRK
*

RE68515.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14543-PA 195 CG14543-PA 1..195 6..200 1028 100 Plus

RE68515.pep Sequence

Translation from 16 to 603

> RE68515.pep
MAAAQQTEFQKNFRVIVEKIFNHWQDLRLAVEHGMGGRNGQQVAIEIMDY
TYQYCVSNENITQGELVEVLEELMDQEFNTLCDDDSIPEICRNLLRYKLM
AQQNQFPQIEAELSKLPAGKEWLRPDVKITYTPIDGDSSSDEDMDDSDEE
DDNEMGQGDEETPSGSGRMTRSQARKQQAEEFVEPEDGWTTVRRK*

RE68515.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16806-PA 194 GF16806-PA 1..194 1..195 803 81.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11462-PA 195 GG11462-PA 1..195 1..195 1012 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19463-PA 201 GH19463-PA 3..201 2..195 771 72.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14543-PA 195 CG14543-PA 1..195 1..195 1028 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24697-PA 194 GI24697-PA 3..194 6..195 748 79.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21826-PA 196 GL21826-PA 1..196 1..195 785 79.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13068-PA 197 GA13068-PA 1..197 1..195 784 80.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10304-PA 194 GM10304-PA 1..194 1..195 1011 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21267-PA 195 GD21267-PA 1..195 1..195 1026 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23913-PA 199 GJ23913-PA 3..199 2..195 738 71.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14463-PA 197 GK14463-PA 4..197 2..195 781 77.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23654-PA 195 GE23654-PA 1..195 1..195 1014 96.9 Plus