BDGP Sequence Production Resources |
Search the DGRC for RE68649
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 686 |
Well: | 49 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG14966-RA |
Protein status: | RE68649.pep: gold |
Sequenced Size: | 588 |
Gene | Date | Evidence |
---|---|---|
CG14966 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14966 | 2008-04-29 | Stopped prior to 5.5 |
CG14966-RA | 2009-01-21 | est gleaning |
588 bp assembled on 2009-11-16
GenBank Submission: BT120373.1
> RE68649.complete TGGATAGACGCCAGTAGACCTCGCAAAATTAAACACTAGTTGCTATTAAA ATGCATTTAAAAACACAAAATATTTAAAATAATTGCCAAGAAGCTAATGC GCCGCTTGTTTACATCGGTCAACGCCCAAATAATGTCGAAGAGCAAGGGG AAATCAAAGGCCGGCGTTGAAAGTGCGAAAAACGATGCAAAAGCGATGCC GGCTAAGGAAGCCAGTCCGATTTCAGTCGATAAGAGCGGCAATATATGCA TACAAATCCTTGCCAAGCCGGGGGCTAAGCAGAACGGAATCACAGGAATT GGCTTTGAAGGAGTGGGCGTCCAAATCGCCGCTCCGCCCAGCGAGGGAGA AGCTAACGCCGAACTGGTCAAGTTTCTGTCGAAAGTTCTAGGTCTTCGAA AGAGCGACGTTTCTTTGGACAAGGGATCTCGATCGCGAAACAAGATAATA ATGATAACCAAGGGAGTGTCCACGGTGGAGGCCATTGAGCAGCTGCTGCG CAAAGAATCCGATTCATAGATTGTTTATTCCCCCCAATAAATACTCGCTC AGAAGTTAGATTTTTAAAACGCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 3196446..3197013 | 570..3 | 2840 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 3197047..3197614 | 570..3 | 2840 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 3197047..3197614 | 570..3 | 2840 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 3791..3829 | 44..82 | 105 | 74.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 3196444..3197014 | 1..572 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14966-RA | 1..423 | 97..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14966-RA | 1..423 | 97..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14966-RA | 1..423 | 97..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14966-RA | 1..423 | 97..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14966-RA | 1..423 | 97..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14966-RA | 1..423 | 97..519 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14966-RA | 17..587 | 1..572 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14966-RA | 17..587 | 1..572 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3197045..3197615 | 1..572 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3197045..3197615 | 1..572 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3197045..3197615 | 1..572 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 3197045..3197615 | 1..572 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3197045..3197615 | 1..572 | 99 | Minus |
Translation from 96 to 518
> RE68649.pep MRRLFTSVNAQIMSKSKGKSKAGVESAKNDAKAMPAKEASPISVDKSGNI CIQILAKPGAKQNGITGIGFEGVGVQIAAPPSEGEANAELVKFLSKVLGL RKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQLLRKESDS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24383-PA | 126 | GF24383-PA | 18..126 | 32..139 | 473 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14280-PA | 127 | GG14280-PA | 1..127 | 13..139 | 590 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15254-PA | 126 | GH15254-PA | 1..125 | 13..139 | 473 | 77.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14966-PA | 140 | CG14966-PA | 1..140 | 1..140 | 679 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11963-PA | 125 | GI11963-PA | 1..125 | 13..140 | 466 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25246-PA | 125 | GL25246-PA | 1..125 | 13..140 | 493 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13391-PA | 125 | GA13391-PA | 1..125 | 13..140 | 493 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14073-PA | 128 | GM14073-PA | 1..128 | 13..140 | 608 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13347-PA | 128 | GD13347-PA | 1..128 | 13..140 | 611 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12187-PA | 124 | GJ12187-PA | 1..124 | 13..140 | 441 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17477-PA | 127 | GK17477-PA | 28..127 | 41..140 | 433 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20708-PA | 128 | GE20708-PA | 1..128 | 13..140 | 608 | 95.3 | Plus |
Translation from 96 to 518
> RE68649.hyp MRRLFTSVNAQIMSKSKGKSKAGVESAKNDAKAMPAKEASPISVDKSGNI CIQILAKPGAKQNGITGIGFEGVGVQIAAPPSEGEANAELVKFLSKVLGL RKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQLLRKESDS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14966-PA | 140 | CG14966-PA | 1..140 | 1..140 | 679 | 100 | Plus |