Clone RE68649 Report

Search the DGRC for RE68649

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:686
Well:49
Vector:pFlc-1
Associated Gene/TranscriptCG14966-RA
Protein status:RE68649.pep: gold
Sequenced Size:588

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14966 2003-01-01 Sim4 clustering to Release 3
CG14966 2008-04-29 Stopped prior to 5.5
CG14966-RA 2009-01-21 est gleaning

Clone Sequence Records

RE68649.complete Sequence

588 bp assembled on 2009-11-16

GenBank Submission: BT120373.1

> RE68649.complete
TGGATAGACGCCAGTAGACCTCGCAAAATTAAACACTAGTTGCTATTAAA
ATGCATTTAAAAACACAAAATATTTAAAATAATTGCCAAGAAGCTAATGC
GCCGCTTGTTTACATCGGTCAACGCCCAAATAATGTCGAAGAGCAAGGGG
AAATCAAAGGCCGGCGTTGAAAGTGCGAAAAACGATGCAAAAGCGATGCC
GGCTAAGGAAGCCAGTCCGATTTCAGTCGATAAGAGCGGCAATATATGCA
TACAAATCCTTGCCAAGCCGGGGGCTAAGCAGAACGGAATCACAGGAATT
GGCTTTGAAGGAGTGGGCGTCCAAATCGCCGCTCCGCCCAGCGAGGGAGA
AGCTAACGCCGAACTGGTCAAGTTTCTGTCGAAAGTTCTAGGTCTTCGAA
AGAGCGACGTTTCTTTGGACAAGGGATCTCGATCGCGAAACAAGATAATA
ATGATAACCAAGGGAGTGTCCACGGTGGAGGCCATTGAGCAGCTGCTGCG
CAAAGAATCCGATTCATAGATTGTTTATTCCCCCCAATAAATACTCGCTC
AGAAGTTAGATTTTTAAAACGCAAAAAAAAAAAAAAAA

RE68649.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14966-RA 423 CG14966-RA 1..423 97..519 2115 100 Plus
Hsp83-RA 3065 Hsp83-RA 2948..3065 570..453 590 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3196446..3197013 570..3 2840 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3197047..3197614 570..3 2840 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3197047..3197614 570..3 2840 100 Minus
Blast to na_te.dros performed 2019-03-16 14:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 3791..3829 44..82 105 74.4 Plus

RE68649.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:01:56 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3196444..3197014 1..572 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-16 11:51:21 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
CG14966-RA 1..423 97..519 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:24:41 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
CG14966-RA 1..423 97..519 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:32:06 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
CG14966-RA 1..423 97..519 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:45 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
CG14966-RA 1..423 97..519 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-16 11:51:18 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
CG14966-RA 1..423 97..519 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:24:41 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
CG14966-RA 1..423 97..519 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:32:06 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
CG14966-RA 17..587 1..572 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:45 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
CG14966-RA 17..587 1..572 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:01:56 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3197045..3197615 1..572 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:01:56 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3197045..3197615 1..572 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:01:56 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3197045..3197615 1..572 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:32:06 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3197045..3197615 1..572 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:11:48 Download gff for RE68649.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3197045..3197615 1..572 99   Minus

RE68649.pep Sequence

Translation from 96 to 518

> RE68649.pep
MRRLFTSVNAQIMSKSKGKSKAGVESAKNDAKAMPAKEASPISVDKSGNI
CIQILAKPGAKQNGITGIGFEGVGVQIAAPPSEGEANAELVKFLSKVLGL
RKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQLLRKESDS*

RE68649.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24383-PA 126 GF24383-PA 18..126 32..139 473 88.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14280-PA 127 GG14280-PA 1..127 13..139 590 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15254-PA 126 GH15254-PA 1..125 13..139 473 77.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14966-PA 140 CG14966-PA 1..140 1..140 679 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11963-PA 125 GI11963-PA 1..125 13..140 466 75 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25246-PA 125 GL25246-PA 1..125 13..140 493 78.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13391-PA 125 GA13391-PA 1..125 13..140 493 78.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14073-PA 128 GM14073-PA 1..128 13..140 608 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13347-PA 128 GD13347-PA 1..128 13..140 611 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12187-PA 124 GJ12187-PA 1..124 13..140 441 75 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17477-PA 127 GK17477-PA 28..127 41..140 433 84 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20708-PA 128 GE20708-PA 1..128 13..140 608 95.3 Plus

RE68649.hyp Sequence

Translation from 96 to 518

> RE68649.hyp
MRRLFTSVNAQIMSKSKGKSKAGVESAKNDAKAMPAKEASPISVDKSGNI
CIQILAKPGAKQNGITGIGFEGVGVQIAAPPSEGEANAELVKFLSKVLGL
RKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQLLRKESDS*

RE68649.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14966-PA 140 CG14966-PA 1..140 1..140 679 100 Plus