Clone RE68712 Report

Search the DGRC for RE68712

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:687
Well:12
Vector:pFlc-1
Associated Gene/TranscriptBet3-RA
Protein status:RE68712.pep: gold
Sequenced Size:1127

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3911 2004-08-13 Blastp of sequenced clone
CG3911 2008-04-29 Release 5.5 accounting
CG3911 2008-08-15 Release 5.9 accounting
CG3891 2008-08-15 Release 5.9 accounting
CG3911 2008-12-18 5.12 accounting
CG3891 2008-12-18 5.12 accounting

Clone Sequence Records

RE68712.complete Sequence

1127 bp (1127 high quality bases) assembled on 2004-08-13

GenBank Submission: BT015980

> RE68712.complete
GTTGTACCCTGACAACCCTGCTCTGTAAAACTAGGAAAAACAGAAAATTT
TATTTTCAATTGTTAAATATCCAAACGTAAACAGCCGGAAAATGTCACGA
CAAGCCTCTCGTTTGGACGCCAAGAAAGTGAACTCGGAGTTCCTGACACT
CACCTACGGAGCACTCGTCACCCAGATGCTGCGCGACTTCGAGAACGCCG
AGGACGTGAACAAGCAGCTGGAGCGAATCGGCTACAACATGGGCATGCGA
CTGATCGAGGACTTTCTGGCCAGGACATCGGCGCCACGCTGCCTCGAGAT
GCGCGAGACGGCCGATCGCATCCAGCAGGCGTTCCGCATCTACCTGAATA
TCCAGCCCACCATCTCGAACTGGTCGCCGGCCTCCGATGAGTTCTCCCTG
GTATTCGATAGCAATCCGCTGACGGAGTTCGTCGAGCTGCCGCCTGACCT
GACCAATCTGCGCTACAGTGCCATACTCAGCGGCTGCATCCGCGGCGCCC
TGGAGATGGTGCAGCTGGAGGTGCAGTGCTGGTTCGTGCAGGATCAACTG
AAGGGCGACAATGTGACGGAACTGCGCGTTAAGTTCGTGCGGCGTCTAGA
GGAGGTCATACCAGCTGGCGAGGATTAGAAAACATTGGTGGATCAGTGCA
TCGGAGCGCAAATAATGAGCTCTTCATTAAATGGGGGTCAATAAAAGCAC
ATTCTGTATAGAAGTTAGCATCGAGTAATCTGCGTTTGTCGTCGTTTTCT
ACACGCCAGTCCACATTCCGGAGCAAAAGCAGCAGGAGCAGCAAGCAGCG
TCCACAGGAGCAACAAGCAGCATCAGGACAACAGGAGCGCAACAGCGGCA
AAATAGCAATATTGGAGCAATAAGAATCGTTACAACAAGTTTAGTTTTAT
GTTTTATTCGACTTTATACAAATGATTTAACTTGGGTATATAAGAAAACA
GTAGAAAATATGTTTCTGTTCATATTTGGCATGATATAAAGCGTCATAAA
CTCCATACAAAAAAACATAATATAGTATAATAGTATTCTATTATTTTTGA
TTAATACAGTTTAACAAATGAAAGTCCCCCACATATAAATATATTATTAC
GTCCCTAAGGCAAAAAAAAAAAAAAAA

RE68712.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
Bet3.a 984 Bet3.a 13..984 2..973 4860 100 Plus
Bet3-RA 688 Bet3-RA 14..688 2..676 3375 100 Plus
MTF-1-RB 3242 MTF-1-RB 3012..3242 1112..882 1155 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9430377..9430951 1111..537 2860 99.8 Minus
chr3L 24539361 chr3L 9431046..9431458 542..130 2065 100 Minus
chr3L 24539361 chr3L 9433994..9434122 130..2 645 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9438481..9439056 1112..537 2880 100 Minus
3L 28110227 3L 9439149..9439561 542..130 2065 100 Minus
3L 28110227 3L 9442124..9442252 130..2 645 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9431581..9432156 1112..537 2880 100 Minus
3L 28103327 3L 9432249..9432661 542..130 2065 100 Minus
3L 28103327 3L 9435224..9435352 130..2 645 100 Minus
Blast to na_te.dros performed 2019-03-16 06:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 1692..1776 963..1047 110 63.6 Plus

RE68712.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:16:49 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9433994..9434122 1..130 99   Minus
chr3L 9430377..9430583 905..1111 100 == Minus
chr3L 9430711..9430946 542..777 99 <- Minus
chr3L 9431047..9431457 131..541 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:33:39 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
CG3911-RA 1..537 92..628 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:32:22 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
Bet3-RA 1..537 92..628 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:39:29 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
Bet3-RA 1..537 92..628 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:16:13 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
CG3911-RA 1..537 92..628 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:15:37 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
Bet3-RA 1..537 92..628 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:37:34 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
CG3911-RA 2..674 2..674 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:32:22 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
Bet3-RA 2..674 2..674 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:29 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
Bet3-RA 15..1125 1..1111 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:16:13 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
CG3911-RA 2..674 2..674 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:15:37 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
Bet3-RA 15..1125 1..1111 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:49 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9438482..9439051 542..1111 100 <- Minus
3L 9439150..9439560 131..541 100 <- Minus
3L 9442124..9442252 1..130 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:49 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9438482..9439051 542..1111 100 <- Minus
3L 9439150..9439560 131..541 100 <- Minus
3L 9442124..9442252 1..130 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:49 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9438482..9439051 542..1111 100 <- Minus
3L 9439150..9439560 131..541 100 <- Minus
3L 9442124..9442252 1..130 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:29 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9431582..9432151 542..1111 100 <- Minus
arm_3L 9432250..9432660 131..541 100 <- Minus
arm_3L 9435224..9435352 1..130 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:53:10 Download gff for RE68712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9431582..9432151 542..1111 100 <- Minus
3L 9432250..9432660 131..541 100 <- Minus
3L 9435224..9435352 1..130 99   Minus

RE68712.pep Sequence

Translation from 91 to 627

> RE68712.pep
MSRQASRLDAKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNM
GMRLIEDFLARTSAPRCLEMRETADRIQQAFRIYLNIQPTISNWSPASDE
FSLVFDSNPLTEFVELPPDLTNLRYSAILSGCIRGALEMVQLEVQCWFVQ
DQLKGDNVTELRVKFVRRLEEVIPAGED*

RE68712.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24668-PA 171 GF24668-PA 1..171 8..178 860 93.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14039-PA 150 GG14039-PA 1..150 29..178 796 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15529-PA 170 GH15529-PA 5..170 13..178 841 94.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Bet3-PA 178 CG3911-PA 1..178 1..178 907 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16806-PA 174 GI16806-PA 10..174 14..178 831 93.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17970-PA 178 GL17970-PA 1..178 1..178 911 96.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28353-PA 169 GA28353-PA 5..169 14..178 847 96.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24872-PA 178 GM24872-PA 1..178 1..178 941 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12923-PA 178 GD12923-PA 1..178 1..178 941 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12552-PA 167 GJ12552-PA 3..167 14..178 846 95.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16614-PA 178 GK16614-PA 1..178 1..178 919 97.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21242-PA 150 GE21242-PA 1..150 29..178 796 100 Plus

RE68712.hyp Sequence

Translation from 91 to 627

> RE68712.hyp
MSRQASRLDAKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNM
GMRLIEDFLARTSAPRCLEMRETADRIQQAFRIYLNIQPTISNWSPASDE
FSLVFDSNPLTEFVELPPDLTNLRYSAILSGCIRGALEMVQLEVQCWFVQ
DQLKGDNVTELRVKFVRRLEEVIPAGED*

RE68712.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
Bet3-PA 178 CG3911-PA 1..178 1..178 907 100 Plus