Clone RE68889 Report

Search the DGRC for RE68889

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:688
Well:89
Vector:pFlc-1
Associated Gene/TranscriptDesi-RA
Protein status:RE68889.pep: gold
Sequenced Size:1016

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14686 2003-01-01 Sim4 clustering to Release 3
CG14686 2004-04-27 Blastp of sequenced clone
CG14686 2008-04-29 Release 5.5 accounting
CG14686 2008-08-15 Release 5.9 accounting
CG14686 2008-12-18 5.12 accounting

Clone Sequence Records

RE68889.complete Sequence

1016 bp (1016 high quality bases) assembled on 2004-04-27

GenBank Submission: BT014639

> RE68889.complete
AGTGTGGAGCAGAGCGAACGACACGTTGGAGCCACGAGCCAAAAACCCCA
AAGGACTATTACTAATTTACAAAAAAAAAAAAAGAAACCCAAAAGGATAC
CCTCTTAAAAGAGCACAATGAACCGAAATTACATTGTCATACTGCAGCTG
CTGGGAGTGTTGGTTGTGCTGACCTACGCCAGTGCAATCCCCAAATACGA
AGATAGCCATAAGTTCTATGCGGATAAGGCGCAGCGGGATAGGTCGTACT
TTAATGAAAACAAGACCCAGCCTAGTGAACCGCAGACAGCTTCCACGAAG
GATAGACTGGAACGACTGGGCTATACCACTGGCTACGGATCCCTAAATGG
TTATCCTGGCGGTACTGGACTATCCGCCTACAATCCCATAAAACTGGACC
TGGGTGGCGTTGTCTTAGGAACTCTTGTGGGCATAGGTGCCATTATACTG
ATTCCTAAGATTCTATCCGCCTTCCATGGTGGTTATGGAGGCTACGGCCG
CAGCGAGGACAGTGACCTAACACCACTGAGCAGCATGATCAATAAGATTG
ACGATGTTCTGGGCCAGAATAATATTGACTCGACGAGTTGCATGCAACGT
GCTGTGTGCGGTTATGTTCGCTCTACGGAGTATAATATGAAGATCGGTTC
CTCAGACCAGATGGACGAATTTATTCATATGCTAGCGGAAAATGCCCTGG
TGGATTACCTCCTCGATGGAACGGCTATTAAGGAGGCATTGGAGCATGGA
AAGCGAGCCAATGATCGAGCCTGTGAAGAGGTGTACTCCAATTGTCCGCT
GGACAGTAAATCAGCTACGGATATTCTAATGAAGCTGATGCCAAAGAAAA
ACCCACAAGGAAAAGGAAAATCATCTGGAATTTCCCGAGAAAAGAAGGTT
TAGTTAATGTTGTTCTATGAAATTTTAAAAAATTGTTCTCCATTTGCATA
CAACCAAATATTTTCCCAACATATAAATAAACTCCATTGTGTTATCTTTA
AAAAAAAAAAAAAAAA

RE68889.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14686-RA 1026 CG14686-RA 28..1026 1..999 4980 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6606036..6606345 690..999 1550 100 Plus
chr3R 27901430 chr3R 6605095..6605308 1..214 1055 99.5 Plus
chr3R 27901430 chr3R 6605781..6605967 503..689 935 100 Plus
chr3R 27901430 chr3R 6605569..6605727 349..507 780 99.4 Plus
chr3R 27901430 chr3R 6605358..6605494 213..349 685 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10780516..10780826 690..1000 1555 100 Plus
3R 32079331 3R 10779575..10779788 1..214 1055 99.5 Plus
3R 32079331 3R 10780261..10780447 503..689 935 100 Plus
3R 32079331 3R 10780049..10780207 349..507 780 99.4 Plus
3R 32079331 3R 10779838..10779974 213..349 685 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10521347..10521657 690..1000 1555 100 Plus
3R 31820162 3R 10520406..10520619 1..214 1055 99.5 Plus
3R 31820162 3R 10521092..10521278 503..689 935 100 Plus
3R 31820162 3R 10520880..10521038 349..507 780 99.3 Plus
3R 31820162 3R 10520669..10520805 213..349 685 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:50:08 has no hits.

RE68889.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:51:12 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6605569..6605722 349..502 100 -> Plus
chr3R 6605781..6605967 503..689 100 -> Plus
chr3R 6606036..6606345 690..999 100   Plus
chr3R 6605095..6605306 1..212 99 -> Plus
chr3R 6605358..6605493 213..348 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:33:46 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
CG14686-RA 1..786 118..903 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:36:26 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
CG14686-RA 1..786 118..903 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:58:59 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
Desi-RA 1..786 118..903 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:20:15 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
CG14686-RA 1..786 118..903 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:57:30 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
Desi-RA 1..786 118..903 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:43:34 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
CG14686-RA 1..995 1..995 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:36:25 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
CG14686-RA 1..999 1..999 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:58:59 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
Desi-RA 7..1005 1..999 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:20:15 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
CG14686-RA 1..995 1..995 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:57:30 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
Desi-RA 7..1005 1..999 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:12 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10779575..10779786 1..212 99 -> Plus
3R 10779838..10779973 213..348 100 -> Plus
3R 10780049..10780202 349..502 100 -> Plus
3R 10780261..10780447 503..689 100 -> Plus
3R 10780516..10780825 690..999 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:12 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10779575..10779786 1..212 99 -> Plus
3R 10779838..10779973 213..348 100 -> Plus
3R 10780049..10780202 349..502 100 -> Plus
3R 10780261..10780447 503..689 100 -> Plus
3R 10780516..10780825 690..999 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:12 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10779575..10779786 1..212 99 -> Plus
3R 10779838..10779973 213..348 100 -> Plus
3R 10780049..10780202 349..502 100 -> Plus
3R 10780261..10780447 503..689 100 -> Plus
3R 10780516..10780825 690..999 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:58:59 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6605560..6605695 213..348 100 -> Plus
arm_3R 6605771..6605924 349..502 100 -> Plus
arm_3R 6605983..6606169 503..689 100 -> Plus
arm_3R 6605297..6605508 1..212 99 -> Plus
arm_3R 6606238..6606547 690..999 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:57:33 Download gff for RE68889.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10520406..10520617 1..212 99 -> Plus
3R 10520669..10520804 213..348 100 -> Plus
3R 10520880..10521033 349..502 100 -> Plus
3R 10521092..10521278 503..689 100 -> Plus
3R 10521347..10521656 690..999 100   Plus

RE68889.pep Sequence

Translation from 117 to 902

> RE68889.pep
MNRNYIVILQLLGVLVVLTYASAIPKYEDSHKFYADKAQRDRSYFNENKT
QPSEPQTASTKDRLERLGYTTGYGSLNGYPGGTGLSAYNPIKLDLGGVVL
GTLVGIGAIILIPKILSAFHGGYGGYGRSEDSDLTPLSSMINKIDDVLGQ
NNIDSTSCMQRAVCGYVRSTEYNMKIGSSDQMDEFIHMLAENALVDYLLD
GTAIKEALEHGKRANDRACEEVYSNCPLDSKSATDILMKLMPKKNPQGKG
KSSGISREKKV*

RE68889.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17901-PA 261 GF17901-PA 1..261 1..261 1222 90 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17672-PA 261 GG17672-PA 1..261 1..261 1360 98.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18058-PA 260 GH18058-PA 1..259 1..258 1021 74.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Desi-PA 261 CG14686-PA 1..261 1..261 1349 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23735-PA 260 GI23735-PA 1..255 1..254 996 75.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21914-PA 261 GL21914-PA 1..260 1..260 1105 80 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22525-PA 184 GA22525-PA 1..172 78..249 810 89 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23895-PA 261 GM23895-PA 1..261 1..261 1366 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18707-PA 261 GD18707-PA 1..261 1..261 1367 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10581-PA 243 GJ10581-PA 2..243 21..261 967 76.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13896-PA 253 GK13896-PA 21..252 21..254 1078 87.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26047-PA 261 GE26047-PA 1..261 1..261 1352 97.7 Plus

RE68889.hyp Sequence

Translation from 117 to 902

> RE68889.hyp
MNRNYIVILQLLGVLVVLTYASAIPKYEDSHKFYADKAQRDRSYFNENKT
QPSEPQTASTKDRLERLGYTTGYGSLNGYPGGTGLSAYNPIKLDLGGVVL
GTLVGIGAIILIPKILSAFHGGYGGYGRSEDSDLTPLSSMINKIDDVLGQ
NNIDSTSCMQRAVCGYVRSTEYNMKIGSSDQMDEFIHMLAENALVDYLLD
GTAIKEALEHGKRANDRACEEVYSNCPLDSKSATDILMKLMPKKNPQGKG
KSSGISREKKV*

RE68889.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Desi-PA 261 CG14686-PA 1..261 1..261 1349 100 Plus