Clone RE69226 Report

Search the DGRC for RE69226

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:692
Well:26
Vector:pFlc-1
Associated Gene/TranscriptCpr64Ad-RB
Protein status:RE69226.pep: gold
Preliminary Size:708
Sequenced Size:970

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1259 2001-12-13 Blastp of sequenced clone
CG1259 2002-01-01 Sim4 clustering to Release 2
CG1259 2003-01-01 Sim4 clustering to Release 3
Cpr64Ad 2008-04-29 Release 5.5 accounting
Cpr64Ad 2008-08-15 Release 5.9 accounting
Cpr64Ad 2008-12-18 5.12 accounting

Clone Sequence Records

RE69226.complete Sequence

970 bp (970 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070590

> RE69226.complete
GGTGTCAGTTCATTTTCGATAACCGACGGTGACAATCGCACTAAACCCCC
ACCCAAGCCTTACAATGAATCCTCTGACGGTTGTTGCAGTCCTTTCCTCG
ATGGCCCTCTCGGCTCAGGCTGGTCTGGTTGGCGCTCCTCTGGCCGCCGC
TCCTCTGGGTGCTCCTCTGGCTTACTCCGCCCCTCTGGGACCTGCTCCAT
ACTTCGCCCCGGCTGCGTACTCCGCCCCTCTGGGCTACGCGGCTCCTTTG
GGATACAACGCCCCTCTGGTGGCGGGACCTGCTCCCCTGGTGTCCAAGAC
CTACGCTGCCGCTCCTTTCGCCGCTCCCTTCGCTGCTCCAGTTGCCCCAG
TTGCTGCTCGCCTGGCTGCCCCAGTCGCCGCTCCTCTCGCTGCCCCAGTT
GCTCCAGTAGCCGCTCCCCTGGCTGCTCCAGTTGCTGCTCCCCTGGCTGC
TCCAGTTGCTGCTCCCATCGCCACCGAGATCGTGGATGCCCACCCACAGT
ACAAGTTCGCCTACGATGTCCAGGATACGCTAACCGGTGACTCCAAGACC
CAGGAGGAGACTCGTGATGGTGATGTCGTCCGTGGATCCTACTCTCTGAT
CGAGCCCGATGGTTCCCGTCGTATTGTCAGCTACTACGCCGACTCCATCA
ACGGTTTCAACGCAGTGGTGCAGAAGGATGTGCCCGTGGCTGTTGCCCCA
GTGGCTCCAGTTTTGGCCAAGACCGTGGCTGCTCCAGTGGCTCCAGTTGT
GGCTGCTGCCCCCGCTCCAGTCTTCGCCAAGACCCTGGCCGCTCCCATCG
TCGCCTAAGTAGAAGGAGGAGAAGTAGGAGTCGTAAAGGAAGTATTGACC
GCAATTCGACAAAGGACTTTCATCTGTACATATTCGATTAATCATTGTCG
AGCTATTGAATAACTTTCATCGCAAAAACCCAAAATTAAAGAAATTCTGA
AAGCAAAAAAAAAAAAAAAA

RE69226.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ad-RB 1088 Cpr64Ad-RB 82..1037 3..958 4765 99.8 Plus
Cpr64Ab-RA 676 Cpr64Ab-RA 236..427 482..673 270 76 Plus
Ccp84Af-RA 680 Ccp84Af-RA 322..500 485..663 250 75.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4214925..4215798 79..952 4370 100 Plus
chr3L 24539361 chr3L 4214774..4214852 3..81 395 100 Plus
chr3L 24539361 chr3L 4210453..4210644 673..482 270 76 Minus
chr3R 27901430 chr3R 2515576..2515754 663..485 250 76 Minus
chr3R 27901430 chr3R 2512960..2513095 536..671 245 78.7 Plus
chr3R 27901430 chr3R 2521545..2521719 672..498 245 76 Minus
chr3R 27901430 chr3R 2518821..2518948 485..612 235 78.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4215539..4216418 79..958 4385 99.9 Plus
3L 28110227 3L 4215388..4215466 3..81 395 100 Plus
3L 28110227 3L 4211067..4211258 673..482 270 76 Minus
3R 32079331 3R 6689782..6689960 663..485 250 76 Minus
3R 32079331 3R 6687148..6687283 536..671 245 78.7 Plus
3R 32079331 3R 6695754..6695928 672..498 245 76 Minus
3R 32079331 3R 6693027..6693154 485..612 235 78.9 Plus
3L 28110227 3L 1841060..1841112 615..563 190 90.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4215539..4216418 79..958 4385 99.8 Plus
3L 28103327 3L 4215388..4215466 3..81 395 100 Plus
3L 28103327 3L 4211067..4211258 673..482 270 76 Minus
3R 31820162 3R 6430613..6430791 663..485 250 75.9 Minus
3R 31820162 3R 6427979..6428114 536..671 245 78.6 Plus
3R 31820162 3R 6436585..6436759 672..498 245 76 Minus
3R 31820162 3R 6433858..6433985 485..612 235 78.9 Plus
3L 28103327 3L 1841060..1841112 615..563 190 90.5 Minus
Blast to na_te.dros performed 2019-03-16 12:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2764..2817 358..305 126 70.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2768..2845 759..681 122 63.3 Minus

RE69226.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:51:14 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4214770..4214850 1..79 97 -> Plus
chr3L 4214926..4215150 80..304 100 == Plus
chr3L 4215310..4215800 464..954 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:00 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 1..744 65..808 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:11 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 1..744 65..808 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:59:39 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 1..744 65..808 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:23 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 1..744 65..808 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:57:32 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 1..744 65..808 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:56 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 1..956 1..954 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:11 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 2..953 3..954 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:59:39 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 6..961 1..954 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:23 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 1..956 1..954 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:57:32 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ad-RB 6..961 1..954 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:14 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4215384..4215464 1..79 97 -> Plus
3L 4215540..4216414 80..954 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:14 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4215384..4215464 1..79 97 -> Plus
3L 4215540..4216414 80..954 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:14 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4215384..4215464 1..79 97 -> Plus
3L 4215540..4216414 80..954 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:59:39 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4215384..4215464 1..79 97 -> Plus
arm_3L 4215540..4216414 80..954 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:12 Download gff for RE69226.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4215540..4216414 80..954 99   Plus
3L 4215384..4215464 1..79 97 -> Plus

RE69226.pep Sequence

Translation from 64 to 807

> RE69226.pep
MNPLTVVAVLSSMALSAQAGLVGAPLAAAPLGAPLAYSAPLGPAPYFAPA
AYSAPLGYAAPLGYNAPLVAGPAPLVSKTYAAAPFAAPFAAPVAPVAARL
AAPVAAPLAAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAHPQYKFAY
DVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNA
VVQKDVPVAVAPVAPVLAKTVAAPVAPVVAAAPAPVFAKTLAAPIVA*

RE69226.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10564-PA 254 GF10564-PA 1..253 1..246 477 70.9 Plus
Dana\GF21621-PA 486 GF21621-PA 58..133 129..204 298 65.8 Plus
Dana\GF23876-PA 119 GF23876-PA 23..110 126..212 296 70.8 Plus
Dana\GF21210-PA 141 GF21210-PA 28..138 109..238 290 51.5 Plus
Dana\GF17186-PA 221 GF17186-PA 62..131 136..205 283 70 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15206-PA 255 GG15206-PA 1..255 1..247 1094 94.9 Plus
Dere\GG14206-PA 148 GG14206-PA 51..142 126..216 297 67.7 Plus
Dere\GG23748-PA 515 GG23748-PA 97..172 129..204 288 64.5 Plus
Dere\GG18788-PA 145 GG18788-PA 54..141 136..218 279 63.6 Plus
Dere\GG10313-PA 151 GG10313-PA 52..120 136..204 274 69.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15933-PA 297 GH15933-PA 187..296 137..246 368 76.4 Plus
Dgri\GH19488-PA 195 GH19488-PA 34..114 131..211 297 65.4 Plus
Dgri\GH18128-PA 166 GH18128-PA 57..126 136..205 285 71.4 Plus
Dgri\GH19487-PA 201 GH19487-PA 65..134 136..205 277 70 Plus
Dgri\GH19489-PA 147 GH19489-PA 39..136 121..223 274 58.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ad-PB 247 CG1259-PB 1..247 1..247 1226 100 Plus
Ccp84Ad-PA 199 CG2341-PA 2..161 86..242 349 54.3 Plus
Ccp84Aa-PA 205 CG2360-PA 3..161 85..242 339 52.8 Plus
Cpr31A-PA 340 CG33302-PA 6..231 4..245 339 42.5 Plus
Ccp84Ab-PA 221 CG1252-PA 3..161 85..242 334 52.1 Plus
Cpr5C-PA 145 CG4052-PA 2..142 86..231 326 53.7 Plus
Cpr64Aa-PA 192 CG15006-PA 11..163 94..247 323 52.9 Plus
Ccp84Ae-PA 208 CG1330-PA 2..161 90..246 318 46.7 Plus
Ccp84Af-PA 151 CG1331-PA 2..145 86..236 313 52.9 Plus
Ccp84Ag-PA 191 CG2342-PA 22..131 126..246 313 55.4 Plus
Cpr64Ab-PA 120 CG15007-PA 23..116 126..218 299 67.4 Plus
Cpr92A-PA 245 CG6240-PA 41..156 117..244 280 50 Plus
Cpr64Ac-PA 188 CG15008-PA 33..180 89..235 276 48.3 Plus
Crys-PB 477 CG16963-PB 60..135 129..204 262 64.5 Plus
Crys-PA 477 CG16963-PA 60..135 129..204 262 64.5 Plus
Ccp84Ac-PA 217 CG1327-PA 60..158 141..244 260 56.2 Plus
Cpr62Bb-PC 194 CG13935-PC 32..155 143..245 254 52 Plus
Cpr62Bb-PB 194 CG13935-PB 32..155 143..245 254 52 Plus
Cpr62Bb-PA 194 CG13935-PA 32..155 143..245 254 52 Plus
CG34461-PB 138 CG34461-PB 4..133 89..233 249 45.9 Plus
CG34461-PA 138 CG34461-PA 4..133 89..233 249 45.9 Plus
Cpr62Bc-PB 180 CG1919-PB 50..165 142..247 249 50.9 Plus
Cpr62Bc-PA 180 CG1919-PA 50..165 142..247 249 50.9 Plus
Cpr76Bd-PD 1228 CG9299-PD 986..1209 3..202 237 36 Plus
Cpr76Bd-PB 1228 CG9299-PB 986..1209 3..202 237 36 Plus
Cpr76Bd-PC 1231 CG9299-PC 1009..1212 3..202 235 36.1 Plus
Edg84A-PA 188 CG2345-PA 17..120 124..233 232 48.2 Plus
Cpr30F-PA 146 CG31876-PA 15..137 116..244 218 42.7 Plus
Cpr66Cb-PA 162 CG7076-PA 85..151 142..208 217 64.2 Plus
Cpr23B-PA 302 CG2973-PA 157..239 146..239 203 50 Plus
Cpr76Bb-PA 198 CG9290-PA 83..144 143..204 202 62.9 Plus
CG18294-PA 141 CG18294-PA 16..122 27..137 198 50.8 Plus
CG13049-PA 181 CG13049-PA 43..176 3..134 197 46.5 Plus
CG14095-PA 162 CG14095-PA 15..139 15..135 196 45.7 Plus
CG13047-PB 170 CG13047-PB 1..165 1..144 193 44.8 Plus
Cpr30B-PA 153 CG3818-PA 33..138 146..243 190 44.3 Plus
Cpr76Ba-PA 204 CG9283-PA 97..157 143..203 189 60.7 Plus
CG13049-PA 181 CG13049-PA 5..181 7..148 188 39.2 Plus
CG12519-PB 131 CG12519-PB 24..127 48..142 185 47.2 Plus
CG12519-PA 131 CG12519-PA 24..127 48..142 185 47.2 Plus
Cpr76Bc-PD 424 CG9295-PD 53..113 143..203 180 57.4 Plus
Cpr76Bc-PC 424 CG9295-PC 53..113 143..203 180 57.4 Plus
CG42367-PC 103 CG42367-PC 14..98 119..205 177 46 Plus
CG13670-PA 266 CG13670-PA 52..159 95..202 172 38.9 Plus
CG13674-PB 137 CG13674-PB 11..132 22..144 168 46.6 Plus
CG13674-PA 137 CG13674-PA 11..132 22..144 168 46.6 Plus
CG14095-PA 162 CG14095-PA 30..159 3..134 166 40.3 Plus
Vml-PB 578 CG34333-PB 59..306 9..240 165 30.2 Plus
Vml-PA 578 CG34333-PA 59..306 9..240 165 30.2 Plus
CG14096-PA 122 CG14096-PA 16..120 27..135 164 46.6 Plus
CG14095-PA 162 CG14095-PA 31..134 66..144 163 48.1 Plus
825-Oak-PB 129 CG32208-PB 19..107 49..136 161 48.4 Plus
CG13679-PB 119 CG13679-PB 16..115 16..135 159 46 Plus
CG32213-PB 129 CG32213-PB 19..107 49..136 159 48.4 Plus
CG13047-PB 170 CG13047-PB 83..168 19..112 146 49 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21372-PA 258 GI21372-PA 1..257 1..246 462 63.6 Plus
Dmoj\GI16582-PA 258 GI16582-PA 1..257 1..246 462 63.6 Plus
Dmoj\GI23757-PA 176 GI23757-PA 46..153 129..242 290 56.4 Plus
Dmoj\GI23842-PA 176 GI23842-PA 46..153 129..242 289 56.4 Plus
Dmoj\GI23758-PA 189 GI23758-PA 34..114 131..211 281 61.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12836-PA 238 GL12836-PA 1..237 1..246 635 72.8 Plus
Dper\GL22049-PA 231 GL22049-PA 66..155 141..236 282 58.3 Plus
Dper\GL15387-PA 536 GL15387-PA 61..134 129..202 282 64.9 Plus
Dper\GL21770-PA 213 GL21770-PA 44..120 127..204 280 66.7 Plus
Dper\GL21772-PA 223 GL21772-PA 33..138 138..242 272 56.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28656-PA 242 GA28656-PA 1..241 1..246 631 71.7 Plus
Dpse\GA28204-PA 142 GA28204-PA 51..124 130..204 284 70.7 Plus
Dpse\GA26062-PA 529 GA26062-PA 61..134 129..202 282 64.9 Plus
Dpse\GA12160-PA 231 GA12160-PA 66..155 141..236 281 58.3 Plus
Dpse\GA26395-PA 213 GA26395-PA 44..120 127..204 280 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14635-PA 258 GM14635-PA 1..258 1..247 1116 95.3 Plus
Dsec\GM13998-PA 147 GM13998-PA 50..141 126..216 297 67.7 Plus
Dsec\GM26665-PA 471 GM26665-PA 58..133 129..204 293 64.5 Plus
Dsec\GM10534-PA 208 GM10534-PA 36..133 131..233 292 55.3 Plus
Dsec\GM12439-PA 145 GM12439-PA 42..142 123..231 286 57.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13823-PA 247 GD13823-PA 1..247 1..247 1133 99.2 Plus
Dsim\GD13279-PA 147 GD13279-PA 50..141 126..216 296 67.7 Plus
Dsim\GD16755-PA 145 GD16755-PA 28..142 109..231 295 59.3 Plus
Dsim\GD23798-PA 505 GD23798-PA 97..172 129..204 294 64.5 Plus
Dsim\GD19526-PA 236 GD19526-PA 54..141 138..226 284 64 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12834-PA 250 GJ12834-PA 1..209 1..205 404 59 Plus
Dvir\GJ23942-PA 183 GJ23942-PA 34..139 131..238 292 58.6 Plus
Dvir\GJ23301-PA 175 GJ23301-PA 46..146 129..226 290 58.4 Plus
Dvir\GJ22511-PA 459 GJ22511-PA 66..136 134..204 281 66.2 Plus
Dvir\GJ23940-PA 200 GJ23940-PA 46..125 129..205 275 63.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12728-PA 241 GK12728-PA 128..240 135..246 432 82.3 Plus
Dwil\GK15169-PA 497 GK15169-PA 68..139 133..204 280 65.3 Plus
Dwil\GK10834-PA 219 GK10834-PA 53..130 127..205 271 65.8 Plus
Dwil\GK12248-PA 219 GK12248-PA 53..130 127..205 271 65.8 Plus
Dwil\GK10833-PA 220 GK10833-PA 73..182 141..244 263 49.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21424-PA 277 GE21424-PA 167..277 137..247 437 100 Plus
Dyak\GE20635-PA 120 GE20635-PA 23..114 126..216 297 67.7 Plus
Dyak\GE18554-PA 476 GE18554-PA 59..134 129..204 293 64.5 Plus
Dyak\GE16433-PA 154 GE16433-PA 29..129 101..205 285 61.9 Plus
Dyak\GE25837-PA 202 GE25837-PA 36..133 131..233 280 56.3 Plus

RE69226.hyp Sequence

Translation from 64 to 807

> RE69226.hyp
MNPLTVVAVLSSMALSAQAGLVGAPLAAAPLGAPLAYSAPLGPAPYFAPA
AYSAPLGYAAPLGYNAPLVAGPAPLVSKTYAAAPFAAPFAAPVAPVAARL
AAPVAAPLAAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAHPQYKFAY
DVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNA
VVQKDVPVAVAPVAPVLAKTVAAPVAPVVAAAPAPVFAKTLAAPIVA*

RE69226.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ad-PB 247 CG1259-PB 1..247 1..247 1226 100 Plus
Ccp84Ad-PA 199 CG2341-PA 2..161 86..242 349 54.3 Plus
Ccp84Aa-PA 205 CG2360-PA 3..161 85..242 339 52.8 Plus
Ccp84Ab-PA 221 CG1252-PA 3..161 85..242 334 52.1 Plus
Cpr5C-PA 145 CG4052-PA 2..142 86..231 326 53.7 Plus