Clone RE69448 Report

Search the DGRC for RE69448

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:694
Well:48
Vector:pFlc-1
Associated Gene/TranscriptGapdh1-RA
Protein status:RE69448.pep: gold
Sequenced Size:1342

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12055 2001-12-13 Blastp of sequenced clone
CG12055 2002-01-01 Sim4 clustering to Release 2
CG12055 2003-01-01 Sim4 clustering to Release 3
Gapdh1 2008-04-29 Release 5.5 accounting
Gapdh1 2008-08-15 Release 5.9 accounting
Gapdh1 2008-12-18 5.12 accounting

Clone Sequence Records

RE69448.complete Sequence

1342 bp (1342 high quality bases) assembled on 2001-12-13

GenBank Submission: AY089643

> RE69448.complete
CCTGATTTGCGAAAAAAGCTCCGGGAAAAGGAAAAAGCGGCAGTCGTAAT
AGCGAACTGAAACTGAACGAGAGTAAAAGTGAAAAGACAGCAGGAACTCA
GCCATGTCGAAGATCGGAATTAACGGATTTGGCCGCATCGGCCGCTTGGT
GCTCCGCGCCGCCATCGATAAGGGCGCCTCCGTGGTGGCCGTCAACGATC
CCTTCATCGATGTCAACTACATGGTTTACCTGTTTAAATTCGACTCGACT
CACGGTCGTTTCAAGGGCACCGTTGCGGCTGAGGGCGGATTCCTGGTGGT
GAACGGCCAGAAGATCACCGTGTTCAGCGAGCGCGACCCGGCCAACATCA
ACTGGGCCAGTGCTGGAGCCGAGTATGTGGTGGAGTCCACCGGAGTGTTC
ACCACCATTGACAAGGCGTCCACCCACTTGAAGGGCGGCGCCAAGAAGGT
CATCATCTCGGCCCCATCCGCCGATGCGCCCATGTTCGTGTGCGGCGTTA
ACCTGGACGCCTACAGCCCCGACATGAAGGTGGTCTCCAACGCCTCGTGC
ACCACCAACTGCCTGGCTCCCCTGGCCAAGGTCATCAATGACAACTTCGA
GATCGTCGAGGGTCTGATGACCACCGTGCACGCCACCACTGCCACCCAGA
AGACCGTCGACGGTCCCTCTGGCAAACTGTGGCGCGATGGACGTGGCGCC
GCCCAGAACATCATCCCGGCCGCCACCGGAGCCGCCAAGGCTGTGGGCAA
GGTCATCCCCGCCCTGAACGGCAAGCTGACCGGCATGGCTTTCCGCGTGC
CCACGCCCAATGTCTCCGTTGTGGATCTTACCGTCCGCTTGGGCAAGGGA
GCCACCTATGACGAAATCAAGGCTAAGGTCGAGGAGGCCTCCAAGGGACC
CCTGAAGGGAATCCTGGGCTACACCGATGAGGAGGTGGTCTCCACCGACT
TCTTCAGCGACACCCATTCGTCTGTGTTCGACGCCAAGGCTGGCATTTCG
CTGAACGATAAGTTCGTCAAGCTAATCTCGTGGTACGACAACGAGTTCGG
TTACTCCAACCGCGTCATCGACCTGATCAAGTATATGCAGAGCAAGGACT
AAACTAGCCAAAACTATCGTACAAACCCGGCGCCCAGCAGCTGGTCGGGA
ATCACTGTTGCATAATCCGCAAGGGGCGCAATTGAGGATGCTTTTTTTTT
CAAATGCACAAAATAGCCATAATTACGCAAAGCTACATATTTATTGTTGT
TGAATAAAGTATCGCCCTGTTACTGTATTTAAATGCCAGCTATTTGAAAA
ATAAAACTTGTGCATCGAATGAAGATAAAAAAAAAAAAAAAA

RE69448.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Gapdh1-RA 1483 Gapdh1-RA 158..1481 1..1325 6570 99.8 Plus
Gapdh1-RB 1285 Gapdh1-RB 1..1283 42..1325 6380 99.9 Plus
Gapdh2-RA 1500 Gapdh2-RA 141..1142 102..1103 3330 88.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3679220..3680543 1325..1 6560 99.8 Minus
chrX 22417052 chrX 15758188..15759189 102..1103 3315 88.7 Plus
chr2R 21145070 chr2R 12846558..12846950 832..440 405 73.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7791900..7793223 1325..1 6560 99.8 Minus
X 23542271 X 15868334..15869335 102..1103 3330 88.8 Plus
2R 25286936 2R 16959364..16959756 832..440 405 73.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7793099..7794422 1325..1 6570 99.8 Minus
X 23527363 X 15876432..15877433 102..1103 3330 88.8 Plus
2R 25260384 2R 16960563..16960688 832..707 195 76.9 Minus
2R 25260384 2R 16960702..16960787 693..608 145 77.9 Minus
2R 25260384 2R 16960813..16960861 582..534 140 85.7 Minus
Blast to na_te.dros performed 2019-03-15 16:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Osvaldo 1543 Osvaldo OSV 1543bp 1398..1489 27..119 128 63.8 Plus
roo 9092 roo DM_ROO 9092bp 6557..6624 55..122 124 64.7 Plus

RE69448.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:39:17 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3679219..3680543 1..1326 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:07 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RB 1..999 104..1102 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:04 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RB 1..999 104..1102 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:06:29 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RA 1..999 104..1102 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:16 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RB 1..999 104..1102 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:17 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RA 1..999 104..1102 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:47 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RA 158..1481 1..1326 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:04 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RA 158..1481 1..1326 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:06:29 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RA 158..1480 1..1324 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:16 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RA 158..1481 1..1326 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:17 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
Gapdh1-RA 158..1480 1..1324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:17 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7791899..7793223 1..1326 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:17 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7791899..7793223 1..1326 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:17 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7791899..7793223 1..1326 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:06:29 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3679404..3680728 1..1326 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:05 Download gff for RE69448.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7793098..7794422 1..1326 99   Minus

RE69448.pep Sequence

Translation from 103 to 1101

> RE69448.pep
MSKIGINGFGRIGRLVLRAAIDKGASVVAVNDPFIDVNYMVYLFKFDSTH
GRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFT
TIDKASTHLKGGAKKVIISAPSADAPMFVCGVNLDAYSPDMKVVSNASCT
TNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAA
QNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGA
TYDEIKAKVEEASKGPLKGILGYTDEEVVSTDFFSDTHSSVFDAKAGISL
NDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD*

RE69448.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17051-PA 332 GF17051-PA 1..332 1..332 1707 97 Plus
Dana\GF13438-PA 771 GF13438-PA 1..330 1..329 1159 63.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10711-PA 332 GG10711-PA 1..332 1..332 1736 99.4 Plus
Dere\GG17924-PA 332 GG17924-PA 1..332 1..332 1708 97 Plus
Dere\GG22232-PA 351 GG22232-PA 1..333 1..332 1146 64 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21340-PA 332 GH21340-PA 1..332 1..332 1685 95.2 Plus
Dgri\GH22833-PA 352 GH22833-PA 1..333 1..332 1158 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Gapdh1-PB 332 CG12055-PB 1..332 1..332 1697 100 Plus
Gapdh1-PA 332 CG12055-PA 1..332 1..332 1697 100 Plus
Gapdh2-PC 332 CG8893-PC 1..332 1..332 1665 97.3 Plus
Gapdh2-PA 332 CG8893-PA 1..332 1..332 1665 97.3 Plus
CG9010-PA 343 CG9010-PA 1..333 1..332 1114 65.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20756-PA 332 GI20756-PA 1..332 1..332 1711 97.3 Plus
Dmoj\GI21211-PA 334 GI21211-PA 3..332 4..332 1158 66.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10260-PA 366 GL10260-PA 1..331 1..331 1703 96.7 Plus
Dper\GL10495-PA 364 GL10495-PA 1..333 1..332 1160 64.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Gapdh2-PA 332 GA21397-PA 1..332 1..332 1715 97.6 Plus
Dpse\GA21475-PA 364 GA21475-PA 1..333 1..332 1155 64.3 Plus
Dpse\GA27234-PA 170 GA27234-PA 89..170 241..332 259 55.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22592-PA 332 GM22592-PA 1..332 1..332 1708 97.3 Plus
Dsec\GM20020-PA 344 GM20020-PA 1..333 1..332 1149 64.6 Plus
Dsec\GM20757-PA 161 GM20757-PA 1..161 172..332 836 98.8 Plus
Dsec\GM20756-PA 149 GM20756-PA 1..149 1..149 779 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25506-PA 344 GD25506-PA 1..333 1..332 1143 64.3 Plus
Dsim\GD17248-PA 147 GD17248-PA 1..143 1..143 735 97.2 Plus
Dsim\GD10219-PA 86 GD10219-PA 3..86 249..332 430 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20492-PA 332 GJ20492-PA 1..332 1..332 1712 97.6 Plus
Dvir\GJ20812-PA 346 GJ20812-PA 1..333 1..332 1149 63.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17768-PA 332 GK17768-PA 1..332 1..332 1703 96.7 Plus
Dwil\GK21310-PA 428 GK21310-PA 1..335 1..332 1204 66.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Gapdh1-PA 332 GE23629-PA 1..332 1..332 1736 99.4 Plus
Dyak\GE17231-PA 332 GE17231-PA 1..332 1..332 1711 97.3 Plus
Dyak\GE14229-PA 350 GE14229-PA 3..332 4..332 1149 64.2 Plus

RE69448.hyp Sequence

Translation from 103 to 1101

> RE69448.hyp
MSKIGINGFGRIGRLVLRAAIDKGASVVAVNDPFIDVNYMVYLFKFDSTH
GRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFT
TIDKASTHLKGGAKKVIISAPSADAPMFVCGVNLDAYSPDMKVVSNASCT
TNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAA
QNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGA
TYDEIKAKVEEASKGPLKGILGYTDEEVVSTDFFSDTHSSVFDAKAGISL
NDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD*

RE69448.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Gapdh1-PB 332 CG12055-PB 1..332 1..332 1697 100 Plus
Gapdh1-PA 332 CG12055-PA 1..332 1..332 1697 100 Plus
Gapdh2-PC 332 CG8893-PC 1..332 1..332 1665 97.3 Plus
Gapdh2-PA 332 CG8893-PA 1..332 1..332 1665 97.3 Plus
CG9010-PA 343 CG9010-PA 1..333 1..332 1114 65.2 Plus