Clone RE69454 Report

Search the DGRC for RE69454

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:694
Well:54
Vector:pFlc-1
Associated Gene/TranscriptCG5757-RA
Protein status:RE69454.pep: gold
Preliminary Size:810
Sequenced Size:884

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5757 2002-01-01 Sim4 clustering to Release 2
CG5757 2003-01-01 Sim4 clustering to Release 3
CG5757 2003-07-07 Blastp of sequenced clone
CG5757 2008-04-29 Release 5.5 accounting
CG5757 2008-08-15 Release 5.9 accounting
CG5757 2008-12-18 5.12 accounting

Clone Sequence Records

RE69454.complete Sequence

884 bp (884 high quality bases) assembled on 2003-07-07

GenBank Submission: AY070593

> RE69454.complete
GGTCGTGTCGCAAACGCCGGTAAGTGCAACATTAAGATCGTAATGAGCGC
GGGAAAACGTGGAGCGTTGATAATATTTGAAGGATGTGATCGAAGTGGAA
AGACCACTCAAAGCAGGCTGTTGGTTGAACTCTTGAAATCGAAGGGCATT
CCGACATTGCCCATGAATTTCCCGGAACGCAGTTCCAGCATTGGTCAGGT
GATAAACTCCTATTTAACGAACAGCAAGGATCTTCCGGATGAGGTGATTC
ACTTAATGTTCTCCGCCAACCGCTGGGAGCACATAAACCAGGTGAAGGAG
AAGCTGCTTGAGGGCACCACATTGGTTGTGGATCGATATTCGTTCTCTGG
CGTGGCATATAGCGCAGCCAAAGGATTAGACTTTGATTGGTGCTATGCTC
CGGAAAGGGGGCTCATAAAACCAGATGCTGTATTTTACCTAAGAGCACCA
CCAAACGACCTTACACATCGAGGACAATACGGCAAAGAGCGTTATGAGAA
AGTAGAATTCCAAGGTCGTGTGGCCGAAGTATTCAACCGCATTTGCTCCA
AGGAGGGCAGCTATTTTCACCAGTTCGATGCCAGACAGTCTGTAGAGGAT
TTACATGCCCAGATAGCGAGCATTACGGAGGAACTCCTGCCCAAAGTGGC
CACCCGACCTCTGGACACGTTATCGTAGCACACGTCCTCGCGTCGCCATT
CATTAGAGGGGATTTACATTGATTTATGCAATACACGAATGTTTGTTATA
AATGTTTTAAATGCCGCTTAACTTTTAATTTACGATAAAGCCGCAGGCAA
TAAATCCTAGCATCGGGCGATTGGAAGGATATCGTTAGGTGTTGAGCGAA
ATGCATTTACAGAATTGCAAAAAAAAAAAAAAAA

RE69454.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG5757.a 1022 CG5757.a 125..993 1..869 4330 99.8 Plus
CG5757-RA 1137 CG5757-RA 197..1065 1..869 4330 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13980817..13981194 868..491 1890 100 Minus
chr2R 21145070 chr2R 13981259..13981626 491..124 1825 99.7 Minus
chr2R 21145070 chr2R 13981678..13981801 124..1 605 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18093722..18094100 869..491 1895 100 Minus
2R 25286936 2R 18094165..18094532 491..124 1840 100 Minus
2R 25286936 2R 18094584..18094707 124..1 605 99.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18094921..18095299 869..491 1895 100 Minus
2R 25260384 2R 18095364..18095731 491..124 1840 100 Minus
2R 25260384 2R 18095783..18095906 124..1 605 99.1 Minus
Blast to na_te.dros performed on 2019-03-15 16:38:29 has no hits.

RE69454.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:39:20 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13980817..13981193 492..868 100 <- Minus
chr2R 13981259..13981625 125..491 99 <- Minus
chr2R 13981678..13981801 1..124 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:08 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 1..636 43..678 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:31:25 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 1..636 43..678 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:06:33 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 1..636 43..678 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:05:05 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 1..636 43..678 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:23 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 1..636 43..678 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:32:40 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 1..863 1..863 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:31:25 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 1..863 1..863 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:06:33 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 30..897 1..868 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:05:05 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 1..863 1..863 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:23 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
CG5757-RA 30..897 1..868 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:20 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18093723..18094099 492..868 100 <- Minus
2R 18094165..18094531 125..491 100 <- Minus
2R 18094584..18094707 1..124 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:20 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18093723..18094099 492..868 100 <- Minus
2R 18094165..18094531 125..491 100 <- Minus
2R 18094584..18094707 1..124 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:20 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18093723..18094099 492..868 100 <- Minus
2R 18094165..18094531 125..491 100 <- Minus
2R 18094584..18094707 1..124 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:06:33 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13982089..13982212 1..124 99   Minus
arm_2R 13981228..13981604 492..868 100 <- Minus
arm_2R 13981670..13982036 125..491 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:43:14 Download gff for RE69454.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18094922..18095298 492..868 100 <- Minus
2R 18095364..18095730 125..491 100 <- Minus
2R 18095783..18095906 1..124 99   Minus

RE69454.hyp Sequence

Translation from 0 to 677

> RE69454.hyp
GHVANAGKCNIKIVMSAGKRGALIIFEGCDRSGKTTQSRLLVELLKSKGI
PTLPMNFPERSSSIGQVINSYLTNSKDLPDEVIHLMFSANRWEHINQVKE
KLLEGTTLVVDRYSFSGVAYSAAKGLDFDWCYAPERGLIKPDAVFYLRAP
PNDLTHRGQYGKERYEKVEFQGRVAEVFNRICSKEGSYFHQFDARQSVED
LHAQIASITEELLPKVATRPLDTLS*

RE69454.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5757-PB 211 CG5757-PB 1..211 15..225 1095 100 Plus
CG5757-PA 211 CG5757-PA 1..211 15..225 1095 100 Plus

RE69454.pep Sequence

Translation from 42 to 677

> RE69454.pep
MSAGKRGALIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSI
GQVINSYLTNSKDLPDEVIHLMFSANRWEHINQVKEKLLEGTTLVVDRYS
FSGVAYSAAKGLDFDWCYAPERGLIKPDAVFYLRAPPNDLTHRGQYGKER
YEKVEFQGRVAEVFNRICSKEGSYFHQFDARQSVEDLHAQIASITEELLP
KVATRPLDTLS*

RE69454.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13205-PA 211 GF13205-PA 1..211 1..211 818 70.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20995-PA 211 GG20995-PA 1..211 1..211 978 84.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20447-PA 211 GH20447-PA 1..210 1..210 709 58.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG5757-PB 211 CG5757-PB 1..211 1..211 1095 100 Plus
CG5757-PA 211 CG5757-PA 1..211 1..211 1095 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19275-PA 211 GI19275-PA 1..211 1..211 677 55.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10538-PA 211 GL10538-PA 1..211 1..211 871 73 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19108-PA 211 GA19108-PA 1..211 1..211 863 72.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19929-PA 182 GM19929-PA 1..182 1..211 862 78.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25418-PA 211 GD25418-PA 1..211 1..211 1082 94.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22153-PA 211 GJ22153-PA 1..211 1..211 741 60.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22056-PA 209 GK22056-PA 2..209 5..211 786 67.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13938-PA 211 GE13938-PA 1..211 1..211 1021 88.6 Plus