Clone RE69515 Report

Search the DGRC for RE69515

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:695
Well:15
Vector:pFlc-1
Associated Gene/TranscriptSec61gamma-RA
Protein status:RE69515.pep: gold
Preliminary Size:570
Sequenced Size:680

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14214 2001-12-13 Blastp of sequenced clone
CG14214 2002-01-01 Sim4 clustering to Release 2
CG14214 2003-01-01 Sim4 clustering to Release 3
Sec61gamma 2008-04-29 Release 5.5 accounting
Sec61gamma 2008-08-15 Release 5.9 accounting
Sec61gamma 2008-12-18 5.12 accounting

Clone Sequence Records

RE69515.complete Sequence

680 bp (680 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070594

> RE69515.complete
CCTAGTGTAGCGTAGCCCTGGCGTTTGACAGCCGACGTGGAGCTGTCATC
GGCAAACACATACGAATAACGGGGTCTACGCGGCAGTCGACGATTGTATC
TCATTTAGTTGGAAATTCTGAATTAAAGCGGAGAATCCCAAATATCTGAC
AAGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGACGCGCCTTCGCC
AAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCCGACCGCAAGGA
GTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTGCATCATGGGCT
TCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCAACAATATCATC
GTGGGCTCTTAAATGCGCTGAGTGGCAAGGAAACCACCAATCATCCAATC
ATCCATTATAGCATACATCAGATCAACGTCTTTTTTTTTCGTTTAGTTAA
CATGCATTATATGTATGGACCATGTGCATTCAGCGAATGCCTTTCTAACA
AAATTCTACACAAACGTACGAAAACGTATTGTAATGTTTCGATATTCCAT
TCATGAACAAGTTAGTTAATAAGATTCAAATGTAAAAAGGAATCACCCGT
CTTCATAGCATTTGTTTGGGGTGCGCATCCCCGCTAATAAATGTTAAATT
GATTTTCCGTGTACAAAAAAAAAAAAAAAA

RE69515.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-RA 858 Sec61gamma-RA 35..698 4..667 3320 100 Plus
CG8860-RA 405 CG8860-RA 95..294 156..355 685 89.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19532655..19533187 132..664 2665 100 Plus
chr2R 21145070 chr2R 8066809..8067008 355..156 685 89.5 Minus
chrX 22417052 chrX 19532127..19532256 4..133 650 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19643863..19644398 132..667 2680 100 Plus
2R 25286936 2R 12179594..12179793 355..156 685 89.5 Minus
X 23542271 X 19643335..19643464 4..133 650 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19651961..19652496 132..667 2680 100 Plus
2R 25260384 2R 12180793..12180992 355..156 685 89.5 Minus
X 23527363 X 19651433..19651562 4..133 650 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:51:33 has no hits.

RE69515.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:52:16 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19532124..19532256 1..133 99 -> Plus
chrX 19532657..19533187 134..664 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:11 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 1..207 156..362 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:13 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 1..207 156..362 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:17 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 1..207 156..362 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:50 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 1..207 156..362 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:36:31 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 1..207 156..362 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:54 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 1..664 1..664 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:13 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 1..664 1..664 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:17 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 6..669 1..664 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:51 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 1..664 1..664 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:36:31 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 6..669 1..664 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:52:16 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
X 19643332..19643464 1..133 99 -> Plus
X 19643865..19644395 134..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:52:16 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
X 19643332..19643464 1..133 99 -> Plus
X 19643865..19644395 134..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:52:16 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
X 19643332..19643464 1..133 99 -> Plus
X 19643865..19644395 134..664 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:17 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19537365..19537497 1..133 99 -> Plus
arm_X 19537898..19538428 134..664 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:55 Download gff for RE69515.complete
Subject Subject Range Query Range Percent Splice Strand
X 19651963..19652493 134..664 100   Plus
X 19651430..19651562 1..133 99 -> Plus

RE69515.pep Sequence

Translation from 155 to 361

> RE69515.pep
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFI
GFFVKLIHIPINNIIVGS*

RE69515.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20416-PA 68 GF20416-PA 1..68 1..68 341 98.5 Plus
Dana\GF12667-PA 105 GF12667-PA 43..105 5..67 200 60.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19242-PA 68 GG19242-PA 1..68 1..68 338 98.5 Plus
Dere\GG22600-PA 68 GG22600-PA 1..68 1..68 336 98.5 Plus
Dere\GG20863-PA 105 GG20863-PA 48..104 10..66 198 66.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21072-PA 169 GH21072-PA 54..103 14..63 184 66 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-PC 68 CG14214-PC 1..68 1..68 348 100 Plus
Sec61gamma-PB 68 CG14214-PB 1..68 1..68 348 100 Plus
Sec61gamma-PA 68 CG14214-PA 1..68 1..68 348 100 Plus
CG8860-PA 68 CG8860-PA 1..68 1..68 339 98.5 Plus
CG13426-PA 105 CG13426-PA 48..104 10..66 196 64.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21533-PA 68 GI21533-PA 1..68 1..68 341 98.5 Plus
Dmoj\GI18672-PA 111 GI18672-PA 57..111 13..67 202 60 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27062-PA 68 GL27062-PA 1..68 1..68 341 98.5 Plus
Dper\GL16814-PA 126 GL16814-PA 69..117 13..61 146 49 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12829-PA 68 GA12829-PA 1..68 1..68 341 98.5 Plus
Dpse\GA24304-PB 105 GA24304-PB 52..96 17..61 143 51.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22977-PA 68 GM22977-PA 1..68 1..68 343 100 Plus
Dsec\GM20379-PA 68 GM20379-PA 1..68 1..68 336 98.5 Plus
Dsec\GM19788-PA 105 GM19788-PA 48..104 10..66 206 68.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15244-PA 68 GD15244-PA 1..68 1..68 336 98.5 Plus
Dsim\GD25279-PA 105 GD25279-PA 48..104 10..66 207 68.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16006-PA 68 GJ16006-PA 1..68 1..68 341 98.5 Plus
Dvir\GJ21688-PA 107 GJ21688-PA 42..107 2..67 217 59.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16225-PA 68 GK16225-PA 1..68 1..68 341 98.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15861-PA 68 GE15861-PA 1..68 1..68 343 100 Plus
Dyak\GE13468-PA 68 GE13468-PA 1..68 1..68 336 98.5 Plus
Dyak\GE13801-PA 105 GE13801-PA 48..104 10..66 198 63.2 Plus

RE69515.hyp Sequence

Translation from 155 to 361

> RE69515.hyp
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFI
GFFVKLIHIPINNIIVGS*

RE69515.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-PC 68 CG14214-PC 1..68 1..68 348 100 Plus
Sec61gamma-PB 68 CG14214-PB 1..68 1..68 348 100 Plus
Sec61gamma-PA 68 CG14214-PA 1..68 1..68 348 100 Plus
CG8860-PA 68 CG8860-PA 1..68 1..68 339 98.5 Plus
CG13426-PA 105 CG13426-PA 48..104 10..66 196 64.9 Plus