BDGP Sequence Production Resources |
Search the DGRC for RE69515
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 695 |
Well: | 15 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Sec61gamma-RA |
Protein status: | RE69515.pep: gold |
Preliminary Size: | 570 |
Sequenced Size: | 680 |
Gene | Date | Evidence |
---|---|---|
CG14214 | 2001-12-13 | Blastp of sequenced clone |
CG14214 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14214 | 2003-01-01 | Sim4 clustering to Release 3 |
Sec61gamma | 2008-04-29 | Release 5.5 accounting |
Sec61gamma | 2008-08-15 | Release 5.9 accounting |
Sec61gamma | 2008-12-18 | 5.12 accounting |
680 bp (680 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070594
> RE69515.complete CCTAGTGTAGCGTAGCCCTGGCGTTTGACAGCCGACGTGGAGCTGTCATC GGCAAACACATACGAATAACGGGGTCTACGCGGCAGTCGACGATTGTATC TCATTTAGTTGGAAATTCTGAATTAAAGCGGAGAATCCCAAATATCTGAC AAGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGACGCGCCTTCGCC AAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCCGACCGCAAGGA GTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTGCATCATGGGCT TCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCAACAATATCATC GTGGGCTCTTAAATGCGCTGAGTGGCAAGGAAACCACCAATCATCCAATC ATCCATTATAGCATACATCAGATCAACGTCTTTTTTTTTCGTTTAGTTAA CATGCATTATATGTATGGACCATGTGCATTCAGCGAATGCCTTTCTAACA AAATTCTACACAAACGTACGAAAACGTATTGTAATGTTTCGATATTCCAT TCATGAACAAGTTAGTTAATAAGATTCAAATGTAAAAAGGAATCACCCGT CTTCATAGCATTTGTTTGGGGTGCGCATCCCCGCTAATAAATGTTAAATT GATTTTCCGTGTACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 19532655..19533187 | 132..664 | 2665 | 100 | Plus |
chr2R | 21145070 | chr2R | 8066809..8067008 | 355..156 | 685 | 89.5 | Minus |
chrX | 22417052 | chrX | 19532127..19532256 | 4..133 | 650 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 19532124..19532256 | 1..133 | 99 | -> | Plus |
chrX | 19532657..19533187 | 134..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 1..207 | 156..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 1..207 | 156..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 1..207 | 156..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 1..207 | 156..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 1..207 | 156..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 1..664 | 1..664 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 1..664 | 1..664 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 6..669 | 1..664 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 1..664 | 1..664 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61gamma-RA | 6..669 | 1..664 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19643332..19643464 | 1..133 | 99 | -> | Plus |
X | 19643865..19644395 | 134..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19643332..19643464 | 1..133 | 99 | -> | Plus |
X | 19643865..19644395 | 134..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19643332..19643464 | 1..133 | 99 | -> | Plus |
X | 19643865..19644395 | 134..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 19537365..19537497 | 1..133 | 99 | -> | Plus |
arm_X | 19537898..19538428 | 134..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19651963..19652493 | 134..664 | 100 | Plus | |
X | 19651430..19651562 | 1..133 | 99 | -> | Plus |
Translation from 155 to 361
> RE69515.pep MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFI GFFVKLIHIPINNIIVGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20416-PA | 68 | GF20416-PA | 1..68 | 1..68 | 341 | 98.5 | Plus |
Dana\GF12667-PA | 105 | GF12667-PA | 43..105 | 5..67 | 200 | 60.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19242-PA | 68 | GG19242-PA | 1..68 | 1..68 | 338 | 98.5 | Plus |
Dere\GG22600-PA | 68 | GG22600-PA | 1..68 | 1..68 | 336 | 98.5 | Plus |
Dere\GG20863-PA | 105 | GG20863-PA | 48..104 | 10..66 | 198 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21072-PA | 169 | GH21072-PA | 54..103 | 14..63 | 184 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sec61gamma-PC | 68 | CG14214-PC | 1..68 | 1..68 | 348 | 100 | Plus |
Sec61gamma-PB | 68 | CG14214-PB | 1..68 | 1..68 | 348 | 100 | Plus |
Sec61gamma-PA | 68 | CG14214-PA | 1..68 | 1..68 | 348 | 100 | Plus |
CG8860-PA | 68 | CG8860-PA | 1..68 | 1..68 | 339 | 98.5 | Plus |
CG13426-PA | 105 | CG13426-PA | 48..104 | 10..66 | 196 | 64.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21533-PA | 68 | GI21533-PA | 1..68 | 1..68 | 341 | 98.5 | Plus |
Dmoj\GI18672-PA | 111 | GI18672-PA | 57..111 | 13..67 | 202 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27062-PA | 68 | GL27062-PA | 1..68 | 1..68 | 341 | 98.5 | Plus |
Dper\GL16814-PA | 126 | GL16814-PA | 69..117 | 13..61 | 146 | 49 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12829-PA | 68 | GA12829-PA | 1..68 | 1..68 | 341 | 98.5 | Plus |
Dpse\GA24304-PB | 105 | GA24304-PB | 52..96 | 17..61 | 143 | 51.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22977-PA | 68 | GM22977-PA | 1..68 | 1..68 | 343 | 100 | Plus |
Dsec\GM20379-PA | 68 | GM20379-PA | 1..68 | 1..68 | 336 | 98.5 | Plus |
Dsec\GM19788-PA | 105 | GM19788-PA | 48..104 | 10..66 | 206 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15244-PA | 68 | GD15244-PA | 1..68 | 1..68 | 336 | 98.5 | Plus |
Dsim\GD25279-PA | 105 | GD25279-PA | 48..104 | 10..66 | 207 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16006-PA | 68 | GJ16006-PA | 1..68 | 1..68 | 341 | 98.5 | Plus |
Dvir\GJ21688-PA | 107 | GJ21688-PA | 42..107 | 2..67 | 217 | 59.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16225-PA | 68 | GK16225-PA | 1..68 | 1..68 | 341 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15861-PA | 68 | GE15861-PA | 1..68 | 1..68 | 343 | 100 | Plus |
Dyak\GE13468-PA | 68 | GE13468-PA | 1..68 | 1..68 | 336 | 98.5 | Plus |
Dyak\GE13801-PA | 105 | GE13801-PA | 48..104 | 10..66 | 198 | 63.2 | Plus |
Translation from 155 to 361
> RE69515.hyp MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFI GFFVKLIHIPINNIIVGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sec61gamma-PC | 68 | CG14214-PC | 1..68 | 1..68 | 348 | 100 | Plus |
Sec61gamma-PB | 68 | CG14214-PB | 1..68 | 1..68 | 348 | 100 | Plus |
Sec61gamma-PA | 68 | CG14214-PA | 1..68 | 1..68 | 348 | 100 | Plus |
CG8860-PA | 68 | CG8860-PA | 1..68 | 1..68 | 339 | 98.5 | Plus |
CG13426-PA | 105 | CG13426-PA | 48..104 | 10..66 | 196 | 64.9 | Plus |