Clone RE69619 Report

Search the DGRC for RE69619

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:696
Well:19
Vector:pFlc-1
Associated Gene/Transcriptmod(r)-RA
Protein status:RE69619.pep: gold
Preliminary Size:1520
Sequenced Size:1385

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17828 2001-12-13 Blastp of sequenced clone
CG17828 2002-01-01 Sim4 clustering to Release 2
CG17828 2003-01-01 Sim4 clustering to Release 3
mod(r) 2008-04-29 Release 5.5 accounting
mod(r) 2008-08-15 Release 5.9 accounting
mod(r) 2008-12-18 5.12 accounting

Clone Sequence Records

RE69619.complete Sequence

1385 bp (1385 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070595

> RE69619.complete
TCATCGCTGTCTGGAACAGCGATGACTCGAGAGCGGAGGGTGGCAGCACT
GAAATGGTCACAGAACGAAAATGCAACTTCGATCGGGGCATATAAAACCA
GTGCTTCCAATCCGAAGGCAAAGCATAAAAGATCAGAACATCAGTAGCCG
AAGATTGGCTGAGTAGCACGGACAGCGGGCAAGTCCTTTGAAACGTTGGT
AGTTTGCAACCGGGTTTGCCAACTTCCTTTGGAGTTCAGTGGTGCTCAAC
TATCGACACAACTATCCTCGGCTTTCGCAAAACTCAGTAAACCGATCTAA
CGCAGACACATTGACATTCGAAAATTGGGATTGAAAACTCAAGATGCCGA
CTACACCACAGGATCTTGCCCTTGCCCACTCTCTTGCTCAAAGACCTCCG
ACCGATAGCAGTGAGGCCAAGGAGCAGGAGGCCGGCGAATCGGACAACCT
GCCCAACCTGTGCACTTTGTCGCTGGACGAACTGAAACAGCTGGACAGGG
ATCCCGAGTTCTTCGAGGACTTCATCGAGGAGATGTCCGTGGTGCAGTAC
CTGAACGAGGAGCTCGATTCAATGATGGACCAGGTGGAGATTATATCAAG
AGAGAACGAGTGCAAGGGCATTCATCTGGTAGAGCTGAAGCGCCGACTCA
GCGACGATTTTACAGCTTTAAAAAACCTAGGCGAGAAATGCGACCGGCTG
AACAAGAAGTACTTCAAGAAGTCGGATGAATACGCGCCTCAGCATATCAG
GGAGCTTCTTCAGATTGCAGCTTCCAATGCCGATGGCGACTGCGATCGTC
ACGTGGAGCACTTCCTGAACGGAAAGACCGACGTGCAGACTTTCCTCAAC
ACGTACCAGTGGTCGAAGAAGATCAGTACCGAGCGCAAGGCCAAAGAGGA
GCGCCTGGGCACCCAGCTCAGTGCTCTGGAGCGGGCCGGTATCTAGGATT
GCCGTGACACTCCCTGGCCGTGCCATCCAGAGCACGGTCCTCCCACTCCT
CGCACTCCTCCCACACCGCCACGATCCGCGTCGCAATAGTAGAGAATATC
AATGTTAGTAAATAGAGAAGTTAAGCCAGAGATGGGGCGACATAATCATG
GCACACACGGCCACGCATTCCCAGAACAGAAAGCAAAACCTTGTTGAAGT
AATAAGAAGGTGCACTAGTTGTTCGTTTCCCAAGATCGTTTACTTGGGAA
GAGGGTCTTGTTATTCTATCCATACCCCGAAACGAAGCACTATGTGCAAC
AGAACGCAGTCCGGAATCGCATGTATTACCTATTTACTTTTTTTCCTTTT
GGTTAATCGTGAGCCCCATCCATATATTCTCTCCATATATACATATATAT
TAAAAAAAAACTATGCTGCAAAAAAAAAAAAAAAA

RE69619.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
mod(r)-RA 1355 mod(r)-RA 26..1354 39..1367 6630 99.9 Plus
mod(r)-RC 1372 mod(r)-RC 297..1359 305..1367 5300 99.9 Plus
mod(r)-RD 1371 mod(r)-RD 42..754 39..751 3565 100 Plus
mod(r)-RD 1371 mod(r)-RD 754..1358 763..1367 3010 99.8 Plus
mod(r)-RC 1372 mod(r)-RC 42..298 39..295 1285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 516426..517042 751..1367 3070 99.8 Plus
chrX 22417052 chrX 515834..516144 294..604 1540 99.7 Plus
chrX 22417052 chrX 515535..515790 39..294 1280 100 Plus
chrX 22417052 chrX 516200..516352 600..752 765 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 622433..623049 751..1367 3070 99.8 Plus
X 23542271 X 621841..622151 294..604 1540 99.7 Plus
X 23542271 X 621542..621797 39..294 1280 100 Plus
X 23542271 X 622207..622359 600..752 765 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 630531..631147 751..1367 3070 99.8 Plus
X 23527363 X 629939..630249 294..604 1540 99.6 Plus
X 23527363 X 629640..629895 39..294 1280 100 Plus
X 23527363 X 630305..630457 600..752 765 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:29:27 has no hits.

RE69619.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:30:05 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 515529..515790 32..294 98 -> Plus
chrX 515835..516139 295..599 100 -> Plus
chrX 516200..516351 600..751 100 -> Plus
chrX 516427..517042 752..1369 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:15 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RC 1..603 344..946 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:19 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RC 1..603 344..946 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:40:12 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RA 1..603 344..946 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:29 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RC 1..603 344..946 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:17:53 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RA 1..603 344..946 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:47:06 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RA 1..1334 32..1366 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:19 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RA 1..1334 32..1366 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:40:12 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RA 7..1341 32..1369 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:29 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RA 1..1334 32..1366 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:17:53 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RA 7..1341 32..1369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:30:05 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
X 621842..622146 295..599 100 -> Plus
X 621534..621797 28..294 97 -> Plus
X 622207..622358 600..751 100 -> Plus
X 622434..623049 752..1369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:30:05 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
X 621842..622146 295..599 100 -> Plus
X 621534..621797 28..294 97 -> Plus
X 622207..622358 600..751 100 -> Plus
X 622434..623049 752..1369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:30:05 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
X 621842..622146 295..599 100 -> Plus
X 621534..621797 28..294 97 -> Plus
X 622207..622358 600..751 100 -> Plus
X 622434..623049 752..1369 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:40:12 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 515567..515830 28..294 97 -> Plus
arm_X 515875..516179 295..599 100 -> Plus
arm_X 516240..516391 600..751 100 -> Plus
arm_X 516467..517082 752..1369 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:21 Download gff for RE69619.complete
Subject Subject Range Query Range Percent Splice Strand
X 629632..629895 28..294 97 -> Plus
X 629940..630244 295..599 100 -> Plus
X 630305..630456 600..751 100 -> Plus
X 630532..631147 752..1369 99   Plus

RE69619.pep Sequence

Translation from 343 to 945

> RE69619.pep
MPTTPQDLALAHSLAQRPPTDSSEAKEQEAGESDNLPNLCTLSLDELKQL
DRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVELKR
RLSDDFTALKNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIAASNADGDC
DRHVEHFLNGKTDVQTFLNTYQWSKKISTERKAKEERLGTQLSALERAGI
*

RE69619.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22102-PA 216 GF22102-PA 27..216 11..200 795 81.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12797-PA 203 GG12797-PA 1..203 1..200 873 82.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24324-PA 194 GH24324-PA 28..194 34..200 774 86.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Vsp37A-PF 200 CG17828-PF 1..200 1..200 1034 100 Plus
Vsp37A-PC 200 CG17828-PC 1..200 1..200 1034 100 Plus
Vsp37A-PA 200 CG17828-PA 1..200 1..200 1034 100 Plus
Vsp37A-PE 196 CG17828-PE 1..196 1..200 1001 98 Plus
Vsp37A-PD 196 CG17828-PD 1..196 1..200 1001 98 Plus
Vsp37A-PB 196 CG17828-PB 1..196 1..200 1001 98 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14804-PA 205 GI14804-PA 37..205 32..200 787 88.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21382-PA 201 GL21382-PA 36..201 35..200 791 89.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14686-PA 201 GA14686-PA 36..201 35..200 790 89.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19076-PA 200 GM19076-PA 1..200 1..200 1038 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16515-PA 200 GD16515-PA 1..200 1..200 1043 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19471-PA 198 GJ19471-PA 30..198 32..200 792 88.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16437-PA 205 GK16437-PA 36..205 31..200 779 87.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16623-PA 203 GE16623-PA 1..203 1..200 888 84.2 Plus

RE69619.hyp Sequence

Translation from 343 to 945

> RE69619.hyp
MPTTPQDLALAHSLAQRPPTDSSEAKEQEAGESDNLPNLCTLSLDELKQL
DRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVELKR
RLSDDFTALKNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIAASNADGDC
DRHVEHFLNGKTDVQTFLNTYQWSKKISTERKAKEERLGTQLSALERAGI
*

RE69619.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
mod(r)-PF 200 CG17828-PF 1..200 1..200 1034 100 Plus
mod(r)-PC 200 CG17828-PC 1..200 1..200 1034 100 Plus
mod(r)-PA 200 CG17828-PA 1..200 1..200 1034 100 Plus
mod(r)-PE 196 CG17828-PE 1..196 1..200 1001 98 Plus
mod(r)-PD 196 CG17828-PD 1..196 1..200 1001 98 Plus