Clone RE69679 Report

Search the DGRC for RE69679

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:696
Well:79
Vector:pFlc-1
Associated Gene/TranscriptGstE2-RA
Protein status:RE69679.pep: gold
Preliminary Size:666
Sequenced Size:907

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17523 2001-12-17 Blastp of sequenced clone
CG17523 2002-01-01 Sim4 clustering to Release 2
GstE2 2008-04-29 Release 5.5 accounting
GstE2 2008-08-15 Release 5.9 accounting
GstE2 2008-12-18 5.12 accounting

Clone Sequence Records

RE69679.complete Sequence

907 bp (907 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071644

> RE69679.complete
TGGGTGGAACTTGGGTCTCTCTGGTGATCGCATCATGTCGGATAAATTGG
TTTTGTATGGCATGGATATTAGTCCTCCTGTTCGCGCTTGCAAGCTGACC
TTGCGGGCCTTAAACTTGGACTACGAATACAAGGAAATGGATCTACTGGC
AGGAGATCACTTTAAGGATGCGTTCCTCAAAAAGAACCCGCAGCACACCG
TACCACTCCTCGAAGATAATGGTGCCCTTATCTGGGATTCACATGCTATT
GTATGCTACCTGGTGGACAAGTATGCCAATTCGGATGAGCTATATCCCAG
GGATCTGGTGTTGCGCGCCCAGGTGGATCAGCGTTTGTTCTTTGATGCCA
GCATTCTGTTTATGTCGCTGCGAAATGTCAGTATACCCTATTTTCTTCGC
CAAGTAAGCCTGGTACCCAAGGAGAAGGTGGACAACATTAAAGATGCATA
TGGCCATTTGGAGAACTTTCTAGGGGATAATCCCTATTTGACCGGGTCGC
AACTGACCATAGCTGATTTATGCTGCGGAGCTACTGCATCCTCGCTGGCC
GCTGTTCTTGACCTGGATGAGTTAAAGTATCCAAAGGTGGCTGCTTGGTT
CGAACGACTCTCTAAGTTGCCCCACTATGAGGAAGACAATCTGCGGGGCT
TGAAGAAGTATATCAATTTATTGAAACCCGTATTAAATCTGGAGCAATAG
TAATTTGTATTAAAAAAAAAATACCATCAAATGCCATAAATACCATAAAA
ACAAATCAAATCGAATAGTACTACAACTGATTTGTAACAAAAACCTATCA
TTTTTAGAATCATAATAAAACTATCATTACGTACTGAATCCTAAAGAGAG
AAATAATAAAAGAGAAATATATAGATGGAAAAACTTAAAAAAAAAAAAAA
AAAAAAA

RE69679.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
GstE2-RA 892 GstE2-RA 6..891 4..889 4400 99.7 Plus
GstE1-RA 835 GstE1-RA 193..319 182..308 275 81.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14286539..14287417 4..883 4290 99.4 Plus
chr2R 21145070 chr2R 14285563..14285797 117..351 305 75.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18399493..18400378 4..889 4400 99.8 Plus
2R 25286936 2R 18398517..18398751 117..351 290 74.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18400692..18401577 4..889 4400 99.7 Plus
2R 25260384 2R 18399781..18399907 182..308 275 81.1 Plus
Blast to na_te.dros performed 2019-03-16 19:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 6206..6301 886..786 124 61.4 Minus

RE69679.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:37:07 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14286536..14286945 1..410 98 == Plus
chr2R 14287005..14287419 470..886 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:44 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
GstE2-RA 1..666 35..700 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:43 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
GstE2-RA 1..666 35..700 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:26 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
GstE2-RA 1..666 35..700 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:37:28 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
GstE2-RA 1..666 35..700 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:25 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
GstE2-RA 3..888 1..886 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:44 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
GstE2-RA 1..883 4..886 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:43 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
GstE2-RA 5..890 1..886 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:26 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
GstE2-RA 3..888 1..886 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:37:28 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
GstE2-RA 5..890 1..886 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:37:07 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18399490..18400375 1..886 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:37:07 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18399490..18400375 1..886 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:37:07 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18399490..18400375 1..886 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:43 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14286995..14287880 1..886 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:59:41 Download gff for RE69679.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18400689..18401574 1..886 99   Plus

RE69679.hyp Sequence

Translation from 34 to 699

> RE69679.hyp
MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKK
NPQHTVPLLEDNGALIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQR
LFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNIKDAYGHLENFLGDNP
YLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYEE
DNLRGLKKYINLLKPVLNLEQ*

RE69679.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
GstE2-PA 221 CG17523-PA 1..221 1..221 1152 100 Plus
GstE1-PA 224 CG5164-PA 3..215 2..214 652 56.3 Plus
GstE7-PA 223 CG17531-PA 3..214 4..214 582 51.4 Plus
GstE10-PB 240 CG17522-PB 4..208 5..207 569 54.6 Plus
GstE10-PA 240 CG17522-PA 4..208 5..207 569 54.6 Plus

RE69679.pep Sequence

Translation from 34 to 699

> RE69679.pep
MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKK
NPQHTVPLLEDNGALIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQR
LFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNIKDAYGHLENFLGDNP
YLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYEE
DNLRGLKKYINLLKPVLNLEQ*

RE69679.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12162-PA 216 GF12162-PA 4..216 5..221 902 77.9 Plus
Dana\GF12168-PA 219 GF12168-PA 4..218 5..219 813 68.4 Plus
Dana\GF12161-PA 223 GF12161-PA 6..215 5..214 637 55.7 Plus
Dana\GF12160-PA 223 GF12160-PA 6..215 5..214 590 49.5 Plus
Dana\GF12766-PA 241 GF12766-PA 4..209 5..207 569 53.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21882-PA 221 GG21882-PA 1..221 1..221 1067 90.5 Plus
Dere\GG21885-PA 219 GG21885-PA 4..218 5..219 810 67.4 Plus
Dere\GG21880-PA 224 GG21880-PA 3..215 2..214 657 55.9 Plus
Dere\GG21881-PA 223 GG21881-PA 3..215 2..214 624 53.5 Plus
Dere\GG20973-PA 240 GG20973-PA 4..208 5..207 582 55.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15974-PA 219 GH15974-PA 3..213 4..214 760 64 Plus
Dgri\GH13568-PA 220 GH13568-PA 3..212 4..214 584 53.1 Plus
Dgri\GH13569-PA 220 GH13569-PA 3..212 4..214 572 52.1 Plus
Dgri\GH21671-PA 221 GH21671-PA 3..213 4..213 569 50.7 Plus
Dgri\GH21668-PA 217 GH21668-PA 3..217 4..218 520 48.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
GstE2-PA 221 CG17523-PA 1..221 1..221 1152 100 Plus
GstE1-PA 224 CG5164-PA 3..215 2..214 652 56.3 Plus
GstE7-PA 223 CG17531-PA 3..214 4..214 582 51.4 Plus
GstE10-PB 240 CG17522-PB 4..208 5..207 569 54.6 Plus
GstE10-PA 240 CG17522-PA 4..208 5..207 569 54.6 Plus
GstE4-PA 222 CG17525-PA 3..214 4..214 561 50 Plus
GstE9-PA 221 CG17534-PA 3..212 4..212 548 49.5 Plus
GstE5-PA 222 CG17527-PA 3..214 4..214 548 48.6 Plus
GstE6-PA 222 CG17530-PA 3..214 4..214 543 49.5 Plus
GstE8-PB 222 CG17533-PB 3..214 4..214 520 47.2 Plus
GstE8-PA 222 CG17533-PA 3..214 4..214 520 47.2 Plus
GstE3-PA 220 CG17524-PA 3..213 4..214 487 46.4 Plus
GstE12-PC 223 CG16936-PC 3..217 4..217 439 44.7 Plus
GstE12-PB 223 CG16936-PB 3..217 4..217 439 44.7 Plus
GstE12-PD 223 CG16936-PD 3..217 4..217 439 44.7 Plus
GstE12-PA 223 CG16936-PA 3..217 4..217 439 44.7 Plus
GstE11-PB 225 CG5224-PB 1..219 1..217 421 40.2 Plus
GstE11-PA 225 CG5224-PA 1..219 1..217 421 40.2 Plus
GstE13-PB 226 CG11784-PB 3..208 4..207 367 36.9 Plus
GstE13-PA 226 CG11784-PA 3..208 4..207 367 36.9 Plus
GstD8-PA 212 CG4421-PA 9..207 13..210 356 39.3 Plus
GstD4-PA 215 CG11512-PA 13..200 17..206 344 38.9 Plus
GstD9-PB 218 CG10091-PB 2..216 5..218 343 38 Plus
GstD9-PA 218 CG10091-PA 2..216 5..218 343 38 Plus
GstD7-PA 224 CG4371-PA 4..206 5..208 340 37.6 Plus
GstD1-PB 209 CG10045-PB 5..207 8..209 336 38 Plus
GstD1-PA 209 CG10045-PA 5..207 8..209 336 38 Plus
GstD6-PA 215 CG4423-PA 3..207 7..210 333 34.3 Plus
GstD2-PA 215 CG4181-PA 13..200 17..206 320 37.4 Plus
GstD3-PA 199 CG4381-PA 4..183 24..205 318 35.7 Plus
GstD11-PA 222 CG17639-PA 5..218 6..218 307 34.7 Plus
GstD11-PB 243 CG17639-PB 26..239 6..218 307 34.7 Plus
GstD5-PA 216 CG12242-PA 6..199 13..205 305 36.2 Plus
GstD10-PB 210 CG18548-PB 3..204 7..209 304 34.6 Plus
GstD10-PA 210 CG18548-PA 3..204 7..209 304 34.6 Plus
GstE14-PA 232 CG4688-PA 5..215 4..216 285 31 Plus
gfzf-PD 234 CG33546-PD 3..186 7..190 247 32.3 Plus
gfzf-PE 1045 CG33546-PE 814..997 7..190 247 32.3 Plus
gfzf-PB 1045 CG33546-PB 814..997 7..190 247 32.3 Plus
GstT2-PA 228 CG30005-PA 1..211 1..200 177 28.8 Plus
GstT1-PA 228 CG30000-PA 1..211 1..200 177 27.8 Plus
GstT3-PC 228 CG1702-PC 1..210 1..199 169 31.5 Plus
GstT3-PA 228 CG1702-PA 1..210 1..199 169 31.5 Plus
GstT3-PB 268 CG1702-PB 41..250 1..199 169 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16624-PA 219 GI16624-PA 3..218 4..219 819 67.6 Plus
Dmoj\GI16623-PA 219 GI16623-PA 3..218 4..219 792 65.3 Plus
Dmoj\GI24095-PA 219 GI24095-PA 3..211 5..214 587 50.5 Plus
Dmoj\GI20124-PA 221 GI20124-PA 3..213 4..213 566 49.8 Plus
Dmoj\GI19388-PA 241 GI19388-PA 3..216 5..217 514 48.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17769-PA 219 GL17769-PA 1..218 1..219 857 74.9 Plus
Dper\GL17768-PA 222 GL17768-PA 1..214 1..214 668 57.5 Plus
Dper\GL16704-PA 241 GL16704-PA 4..209 5..207 564 52.4 Plus
Dper\GL17771-PA 221 GL17771-PA 3..213 4..214 547 49.1 Plus
Dper\GL17773-PA 222 GL17773-PA 3..214 4..214 545 47.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14540-PA 219 GA14540-PA 1..218 1..219 857 74.9 Plus
Dpse\GA18702-PA 222 GA18702-PA 1..214 1..214 667 57.5 Plus
Dpse\GA14539-PA 241 GA14539-PA 4..209 5..207 564 52.4 Plus
Dpse\GA14545-PA 222 GA14545-PA 3..214 4..214 552 48.1 Plus
Dpse\GA14542-PA 221 GA14542-PA 3..213 4..214 540 48.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21875-PA 221 GM21875-PA 1..221 1..221 1107 95.5 Plus
Dsec\GM21878-PA 219 GM21878-PA 1..218 1..219 791 64.8 Plus
Dsec\GM21881-PA 223 GM21881-PA 3..214 4..214 604 51.4 Plus
Dsec\GM19908-PA 240 GM19908-PA 4..208 5..207 579 54.6 Plus
Dsec\GM21879-PA 222 GM21879-PA 3..214 4..214 575 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11372-PA 219 GD11372-PA 4..218 5..219 796 66 Plus
Dsim\GD11370-PA 224 GD11370-PA 3..215 2..214 663 56.8 Plus
Dsim\GD11376-PA 223 GD11376-PA 3..214 4..214 602 51.9 Plus
Dsim\GD25394-PA 240 GD25394-PA 4..208 5..207 580 54.6 Plus
Dsim\GD11373-PA 222 GD11373-PA 3..214 4..214 568 49.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12879-PA 219 GJ12879-PA 4..218 5..219 822 69.8 Plus
Dvir\GJ21357-PA 220 GJ21357-PA 2..212 3..214 620 54.7 Plus
Dvir\GJ22450-PA 238 GJ22450-PA 3..216 5..217 550 49.1 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 3..213 4..213 547 47.4 Plus
Dvir\GJ19893-PA 221 GJ19893-PA 3..213 4..214 543 51.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22982-PA 218 GK22982-PA 3..218 5..220 806 66.2 Plus
Dwil\GK22987-PA 219 GK22987-PA 4..218 5..219 761 64.7 Plus
Dwil\GK22985-PA 219 GK22985-PA 3..218 4..219 747 62.5 Plus
Dwil\GK22983-PA 222 GK22983-PA 3..214 4..214 593 50.5 Plus
Dwil\GK22981-PA 223 GK22981-PA 1..215 1..214 588 51.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GstE2-PA 221 GE11957-PA 1..221 1..221 1075 91 Plus
Dyak\GE11960-PA 219 GE11960-PA 4..218 5..219 819 68.4 Plus
Dyak\GE13914-PA 240 GE13914-PA 4..208 5..207 584 54.6 Plus
Dyak\GE11964-PA 222 GE11964-PA 3..213 4..214 583 50.9 Plus
Dyak\GE11961-PA 222 GE11961-PA 3..214 4..214 575 49.5 Plus