Clone RE70039 Report

Search the DGRC for RE70039

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:700
Well:39
Vector:pFlc-1
Associated Gene/TranscriptHim-RA
Protein status:RE70039.pep: gold
Preliminary Size:579
Sequenced Size:937

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15064 2001-12-13 Blastp of sequenced clone
CG15064 2002-01-01 Sim4 clustering to Release 2
CG15064 2003-01-01 Sim4 clustering to Release 3
Him 2008-04-29 Release 5.5 accounting
Him 2008-08-15 Release 5.9 accounting
Him 2008-12-18 5.12 accounting

Clone Sequence Records

RE70039.complete Sequence

937 bp (937 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070599

> RE70039.complete
ACGGTCTTCCGCCGCAGCTCGACGCGCTCGCATATCGGGAATATATAGAT
CGGAGATATCGCAGGACCCACAGCAGAGCAGAGCCGCAGAGCCACCAACC
TCGATGGGCGTCATCTACAAGATACTGAAGCAGCAACGCAGCATGGATCT
CAGCCTGAGCTCGGCCACCAGGTGCAAGGTGCAGGCGGCCATCAAGCAGC
GCCAGCAGCAGCGCCGCCTTGAGGATCACATGGTGGAGGAGCGGGATCGG
GATCGGGAGCGGGACCAGCAGCCGGATCAGGATCAGAACCAGGTCCAGAA
TCACATCGACAAGGATAAGGAGGAGCTGGCCGAGCAGCAATTACAGCAGC
TGTGCAGATTTCTAGCCGAGAATGCGGCGCGAAAAAAGCGTCAGCGTTTC
AAGCTGCAGTACCAATGCAATCTGGCCATCGATCAGGATAACGATCAGGA
GCAGATGCCGGAGAAGGAGCACTTTGCAGCGCCGCCGCACGAGATGGACC
TCGAGTTCATAGAGCAGCTGCAGCAATCCTCGCCCGCCAAATCCCACGGA
GCAACTGGGCAGGCGCCACGTGATAGCATCCTGCTGAAGATTCGCCACCA
GATCTTCGAGAGAAAGCGGCAGAGGCAGCGCCAGTTGGCGGAGCTGGTGC
AGCAGCGAATGGTGGTGTGGCGACCTTGGTAGCCGGATTCCCCCAAAACA
AGGAGAAAAAGAGGGAGATAGCTAGAAAGTTAGAAAGAGAGAGAGAGAGA
AATCCGGGAACTGAGACTAGTCTAAGGGTTAGCTTTAAGGACGCATTCGG
TATTATTCCTGCTGCTGTGTGATGATCGCGCTGCTCTTCCATTTTCCCAC
GCCTCTGCAAACCGACTTTATTTTTTTTCCTGTTAATAAATAGTTAAGTA
ATAAAGATTTTTTTTGAAAACAAAAAAAAAAAAAAAA

RE70039.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Him-RA 1084 Him-RA 117..1033 4..920 4585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18099391..18099925 387..920 2580 99.3 Plus
chrX 22417052 chrX 18098615..18098999 4..388 1910 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18210212..18210745 387..920 2670 100 Plus
X 23542271 X 18209434..18209818 4..388 1925 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18218310..18218843 387..920 2670 100 Plus
X 23527363 X 18217532..18217916 4..388 1925 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:28:28 has no hits.

RE70039.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:29:11 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18098612..18098999 1..388 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:25 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 1..579 104..682 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:21 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 1..579 104..682 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:13:52 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 1..579 104..682 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:26 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 1..579 104..682 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:22:26 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 1..579 104..682 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:58 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 1..916 1..916 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:21 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 1..916 1..916 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:52 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 5..920 1..916 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:26 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 1..919 1..919 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:22:26 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
Him-RA 5..920 1..916 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:11 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
X 18209431..18209818 1..388 99 -> Plus
X 18210214..18210745 389..921 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:11 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
X 18209431..18209818 1..388 99 -> Plus
X 18210214..18210745 389..921 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:11 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
X 18209431..18209818 1..388 99 -> Plus
X 18210214..18210745 389..921 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:52 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18103464..18103851 1..388 99 -> Plus
arm_X 18104247..18104778 389..921 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:35 Download gff for RE70039.complete
Subject Subject Range Query Range Percent Splice Strand
X 18217529..18217916 1..388 99 -> Plus
X 18218312..18218843 389..921 99   Plus

RE70039.hyp Sequence

Translation from 0 to 681

> RE70039.hyp
QSSAAARRARISGIYRSEISQDPQQSRAAEPPTSMGVIYKILKQQRSMDL
SLSSATRCKVQAAIKQRQQQRRLEDHMVEERDRDRERDQQPDQDQNQVQN
HIDKDKEELAEQQLQQLCRFLAENAARKKRQRFKLQYQCNLAIDQDNDQE
QMPEKEHFAAPPHEMDLEFIEQLQQSSPAKSHGATGQAPRDSILLKIRHQ
IFERKRQRQRQLAELVQQRMVVWRPW*

RE70039.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Him-PA 192 CG15064-PA 1..192 35..226 993 100 Plus

RE70039.pep Sequence

Translation from 103 to 681

> RE70039.pep
MGVIYKILKQQRSMDLSLSSATRCKVQAAIKQRQQQRRLEDHMVEERDRD
RERDQQPDQDQNQVQNHIDKDKEELAEQQLQQLCRFLAENAARKKRQRFK
LQYQCNLAIDQDNDQEQMPEKEHFAAPPHEMDLEFIEQLQQSSPAKSHGA
TGQAPRDSILLKIRHQIFERKRQRQRQLAELVQQRMVVWRPW*

RE70039.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22429-PA 177 GF22429-PA 1..177 1..192 485 62.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19155-PA 178 GG19155-PA 1..178 1..192 836 89.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17719-PA 207 GH17719-PA 1..207 1..192 285 42.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Him-PA 192 CG15064-PA 1..192 1..192 993 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15467-PA 213 GI15467-PA 1..213 1..192 361 43.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26966-PA 195 GL26966-PA 1..195 1..192 525 58.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13466-PA 180 GA13466-PA 1..180 1..192 461 56.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22887-PA 193 GM22887-PA 1..193 1..192 959 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24688-PA 150 GD24688-PA 10..150 53..192 697 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19178-PA 195 GJ19178-PA 1..195 1..192 355 47.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20002-PA 185 GK20002-PA 1..185 1..192 480 57.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17715-PA 190 GE17715-PA 1..190 1..192 864 91.1 Plus