Clone RE70209 Report

Search the DGRC for RE70209

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:702
Well:9
Vector:pFlc-1
Associated Gene/TranscriptCG33932-RA
Protein status:RE70209.pep: gold
Preliminary Size:2079
Sequenced Size:1257

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12533 2002-01-01 Sim4 clustering to Release 2
CG32530 2002-01-03 Blastp of sequenced clone
CG32530 2003-01-01 Sim4 clustering to Release 3
Rpp20 2008-04-29 Release 5.5 accounting
Rpp20 2008-08-15 Release 5.9 accounting
CG33932 2008-08-15 Release 5.9 accounting
CG33932 2008-12-18 5.12 accounting
Rpp20 2008-12-18 5.12 accounting

Clone Sequence Records

RE70209.complete Sequence

1257 bp (1257 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075522

> RE70209.complete
AGTGTTGGCCAGCGTGCGATTCGGAATGGAGTCGCGAGTCCGAAACTGCG
ACACGCGCAGGTAAATGGAAAACACAAGTCGCCTCCTCCGCCGCTGATGA
TGGGAAGCAATTATCCCGAGCACGGGACCAAGCCGAGATCCGCCAAATAC
CACAAACAACAGAACCACCGAGTGGTGCGCAAGCAGCCGCCGCGTCCCGC
TGTTAGCGACCGCCACAACATCTACATCACCAGCAAGACAGACTTTAAGG
CCCAGCAGCGCCGCTGCGAGGAGCTGATTAACTCCGGCGCCCACGAGATC
TTTCTGCATTGCATGGGCTTCTCCGTAACCCGCGGCCTCAATATCGCCCT
ACGCCTCGTCCAGAATTCTGACGGCCCCTTAGCTACGCCATCAACACCTC
CACCGTTCAGCTGGTGGACGAACTGCACCCGCTGTGCGATGCCGAGGACA
TAACCTTCCGCCAGCGCAACAACTCGGCCCTGCACATCAAGATCCTCAAT
AACAGTCTCTTCGACATCGCCGTGCCGCAACCGTCGCAGTCCCAGACGCA
AGCCCAGTCCCTGGGCCAGTTCCGAGGCAAGGCGAAGGCCAGGCAGTAGC
ATGTTCAAACTCTCGGAGCTGGTGCGCTGGCTGGGGCTCACCGAGTTCGA
GATTCTGGTCAATCTGTGCGGCCTGCTGGTGTTCACCATCACGCTGACCG
TCAAGCTCCATCTGCAGGCCAGGGCCGGACCCGGTGGCATACTCCCGGAG
CCCATGGGCGACTGGTTCACCGTCTTCAGCCCCCTGTTCTTCATCGACAT
CTGCAACGCGTACTTTTGCGTCATTGTGGGCATCCGCATGTACCTGGACT
CTAACAACAAGCGCAAAGCCCTGCATCGCTTCATGTGGAGCACGTATTTC
CTGGTGCTCATCGCCATCTTCAAGTACCTGCTCTGCCTGAAGCTATCCAG
CAAGACGGGCCTCGAGTATTCGGAGGTCTTCTCGCCGATCTTCGTTCTGT
TGCAGCTCGTGGCTGTGCGCGCCTGCCAGTTGCCCAACTCCATCTAAACC
ATAGACGTAGTATAGCCCTAGTTCCGTATTATACATATATGTAACTATTC
TGAAAGCCTTTAAATCATTGGATTGGTAGTTATCTGTATACGCAATGTGG
TACAATAATTTTTAAGCGGTACGAAATTTATCTTTCTGGATATAGCATAT
CTAATATATACGAATTATATCTGATCTGATTCGGTATGAAAGAAAAAAAA
AAAAAAA

RE70209.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Rpp20-RA 1242 Rpp20-RA 1..1241 1..1240 6165 99.9 Plus
CG33932-RA 1242 CG33932-RA 1..1241 1..1240 6165 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19633464..19634457 248..1240 4920 99.9 Plus
chrX 22417052 chrX 19633144..19633394 1..251 1255 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19744753..19745746 248..1240 4920 99.9 Plus
X 23542271 X 19744433..19744683 1..251 1255 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19752851..19753844 248..1240 4930 99.8 Plus
X 23527363 X 19752531..19752781 1..251 1255 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:47:54 has no hits.

RE70209.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:48:40 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19633144..19633396 1..255 98 -> Plus
chrX 19633472..19634458 256..1242 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:32 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..504 97..599 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:55:11 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..504 97..599 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:49:17 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..504 97..599 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:20:08 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..504 97..599 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:15:06 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..504 97..599 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:18:55 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..1242 1..1242 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:55:11 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
CG33932-RA 1..1242 1..1242 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:49:17 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 3..1244 1..1242 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:20:08 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
Rpp20-RA 1..1242 1..1242 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:15:06 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
CG33932-RB 3..1244 1..1242 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:40 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
X 19744433..19744685 1..255 98 -> Plus
X 19744761..19745747 256..1242 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:40 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
X 19744433..19744685 1..255 98 -> Plus
X 19744761..19745747 256..1242 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:40 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
X 19744433..19744685 1..255 98 -> Plus
X 19744761..19745747 256..1242 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:49:17 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19638466..19638718 1..255 98 -> Plus
arm_X 19638794..19639780 256..1242 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:54:36 Download gff for RE70209.complete
Subject Subject Range Query Range Percent Splice Strand
X 19752531..19752783 1..255 98 -> Plus
X 19752859..19753845 256..1242 99   Plus

RE70209.pep Sequence

Translation from 600 to 1046

> RE70209.pep
MFKLSELVRWLGLTEFEILVNLCGLLVFTITLTVKLHLQARAGPGGILPE
PMGDWFTVFSPLFFIDICNAYFCVIVGIRMYLDSNNKRKALHRFMWSTYF
LVLIAIFKYLLCLKLSSKTGLEYSEVFSPIFVLLQLVAVRACQLPNSI*

RE70209.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20216-PA 146 GF20216-PA 1..146 1..148 686 91.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19254-PA 148 GG19254-PA 1..148 1..148 765 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17694-PA 144 GH17694-PA 1..144 1..148 632 84.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG33932-PB 148 CG33932-PB 1..148 1..148 770 100 Plus
CG33932-PA 148 CG33932-PA 1..148 1..148 770 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16101-PA 144 GI16101-PA 1..144 1..148 644 85.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15017-PA 145 GL15017-PA 1..145 1..148 630 85.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22562-PA 145 GA22562-PA 1..145 1..148 630 85.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22991-PA 148 GM22991-PA 1..148 1..148 766 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17464-PA 148 GD17464-PA 1..148 1..148 766 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15751-PA 144 GJ15751-PA 1..144 1..148 644 86.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19245-PA 144 GK19245-PA 1..144 1..148 653 87.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15873-PA 148 GE15873-PA 1..148 1..148 766 99.3 Plus

RE70209.hyp Sequence

Translation from 600 to 1046

> RE70209.hyp
MFKLSELVRWLGLTEFEILVNLCGLLVFTITLTVKLHLQARAGPGGILPE
PMGDWFTVFSPLFFIDICNAYFCVIVGIRMYLDSNNKRKALHRFMWSTYF
LVLIAIFKYLLCLKLSSKTGLEYSEVFSPIFVLLQLVAVRACQLPNSI*

RE70209.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG33932-PB 148 CG33932-PB 1..148 1..148 770 100 Plus
CG33932-PA 148 CG33932-PA 1..148 1..148 770 100 Plus