Clone RE70243 Report

Search the DGRC for RE70243

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:702
Well:43
Vector:pFlc-1
Associated Gene/TranscriptCG8353-RA
Protein status:RE70243.pep: gold
Preliminary Size:513
Sequenced Size:767

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8353 2001-12-13 Blastp of sequenced clone
CG8353 2002-01-01 Sim4 clustering to Release 2
CG8353 2003-01-01 Sim4 clustering to Release 3
CG8353 2008-04-29 Release 5.5 accounting
CG8353 2008-08-15 Release 5.9 accounting
CG8353 2008-12-18 5.12 accounting

Clone Sequence Records

RE70243.complete Sequence

767 bp (767 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070601

> RE70243.complete
GTCCATTTGCCATCGGACGTTCAAAGGAGAAACACACGCACTCAACTTGC
TAAAAATAATTCAAAATTTAAGAAAATAGGCGTGCCTCTATTGACCAAAA
GAATTGAACTATAATGACACATCTGACAAAAAATTTCGCACGTCCAGAAA
AGAATGAGGAGGTTGTGACCTTCGGCAGTCTGGATCCGTCGGTTCAAGAA
CTTCTGACAGCTGCTTTTCAAGTGCGCCAGCGGGCATACGTTCCATATAG
TGGCTTCAAAGTTGGGGCTGCTTTTCGGGCCAAGGTCGATGGAAAGATCT
TCACTGGCTGCAATGTGGAAAACGCCGCCTTTACGCCGGGCTCTTGTGCC
GAGAGAACGGCCATTGCTAAGGCCGTAAGCGAAGGAGCCACCGAATTTTT
GGCAGGTGCTGTTTTGGCCTACGAACCTAATGTATTCACCACTCCTTGCG
GCGTTTGTCGTCAGTTTATACGCGAGTTTGCCAACGCGGATATACCCATA
TATGTGGCCCAGGCGATCGATGCGAGGATTGCTGAAAAGCAGGAACTTTT
GCAGAGTGACGATCCCGTCATGTGCACCTCAATCTTTAATCTGTTGCCGA
GCAGTTTTCACACCTATCGAAAGTAACGACCACTGCAGGCAAGAACCGAA
AATAGGCAGAAGGTAGCTAGGTAAAGGTTGTTTCTCAACCCCTTGCTGCC
TCTAATCAATATAATTTTGATCTAATCACTTGCAATAAAGAAAATTACAC
TAAAAAAAAAAAAAAAA

RE70243.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8353-RA 909 CG8353-RA 85..836 1..752 3760 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:10:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8213651..8214219 183..751 2830 99.8 Plus
chr2L 23010047 chr2L 8213285..8213467 1..183 915 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8214671..8215240 183..752 2850 100 Plus
2L 23513712 2L 8214305..8214487 1..183 915 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8214671..8215240 183..752 2850 100 Plus
2L 23513712 2L 8214305..8214487 1..183 915 100 Plus
Blast to na_te.dros performed 2019-03-16 04:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 1977..2131 2..160 111 57.9 Plus

RE70243.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:12:01 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8213285..8213467 1..183 100 -> Plus
chr2L 8213652..8214219 184..751 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:32 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..513 114..626 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:12 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..513 114..626 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:40 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..513 114..626 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:24 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..513 114..626 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:59 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..513 114..626 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:58 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..751 1..751 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:12 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..751 1..751 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:40 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..751 1..751 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:24 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..751 1..751 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:59 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
CG8353-RA 1..751 1..751 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:01 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8214305..8214487 1..183 100 -> Plus
2L 8214672..8215239 184..751 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:01 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8214305..8214487 1..183 100 -> Plus
2L 8214672..8215239 184..751 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:01 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8214305..8214487 1..183 100 -> Plus
2L 8214672..8215239 184..751 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:40 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8214305..8214487 1..183 100 -> Plus
arm_2L 8214672..8215239 184..751 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:14 Download gff for RE70243.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8214672..8215239 184..751 100   Plus
2L 8214305..8214487 1..183 100 -> Plus

RE70243.pep Sequence

Translation from 113 to 625

> RE70243.pep
MTHLTKNFARPEKNEEVVTFGSLDPSVQELLTAAFQVRQRAYVPYSGFKV
GAAFRAKVDGKIFTGCNVENAAFTPGSCAERTAIAKAVSEGATEFLAGAV
LAYEPNVFTTPCGVCRQFIREFANADIPIYVAQAIDARIAEKQELLQSDD
PVMCTSIFNLLPSSFHTYRK*

RE70243.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15274-PA 170 GF15274-PA 1..170 1..170 724 79.4 Plus
Dana\GF15275-PA 264 GF15275-PA 100..263 5..168 447 55.8 Plus
Dana\GF15273-PA 158 GF15273-PA 1..152 1..165 382 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10526-PA 170 GG10526-PA 1..170 1..170 823 90.6 Plus
Dere\GG10527-PA 264 GG10527-PA 100..263 5..168 452 53.9 Plus
Dere\GG10525-PA 158 GG10525-PA 1..153 1..166 383 49.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11514-PA 168 GH11514-PA 1..168 1..168 556 65.3 Plus
Dgri\GH11515-PA 221 GH11515-PA 70..221 14..168 427 55.5 Plus
Dgri\GH11513-PA 159 GH11513-PA 1..153 1..165 353 50.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG8353-PB 170 CG8353-PB 1..170 1..170 875 100 Plus
CG8353-PA 170 CG8353-PA 1..170 1..170 875 100 Plus
CG8349-PA 264 CG8349-PA 100..263 5..168 416 51.5 Plus
CG8360-PC 158 CG8360-PC 1..152 1..165 379 49.4 Plus
CG8360-PA 158 CG8360-PA 1..152 1..165 379 49.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17010-PA 173 GI17010-PA 1..173 1..169 603 65.9 Plus
Dmoj\GI17011-PA 220 GI17011-PA 71..218 15..165 435 57 Plus
Dmoj\GI17009-PA 159 GI17009-PA 1..153 1..165 351 47.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18730-PA 170 GL18730-PA 1..170 1..170 742 81.2 Plus
Dper\GL18731-PA 227 GL18731-PA 63..226 5..168 426 52.1 Plus
Dper\GL18729-PA 158 GL18729-PA 1..153 1..166 388 50.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21012-PA 170 GA21012-PA 1..170 1..170 746 81.8 Plus
Dpse\GA21010-PA 227 GA21010-PA 63..226 5..168 421 51.5 Plus
Dpse\GA21017-PA 158 GA21017-PA 1..153 1..166 388 50.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16858-PA 170 GM16858-PA 1..170 1..170 861 95.3 Plus
Dsec\GM16862-PA 264 GM16862-PA 100..263 5..168 418 52.1 Plus
Dsec\GM16857-PA 158 GM16857-PA 1..152 1..165 370 48.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23516-PA 170 GD23516-PA 1..170 1..170 857 95.3 Plus
Dsim\GD23517-PA 264 GD23517-PA 100..263 5..168 423 52.1 Plus
Dsim\GD23515-PA 158 GD23515-PA 1..153 1..166 386 49.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24356-PA 167 GJ24356-PA 1..167 1..168 607 68 Plus
Dvir\GJ24367-PA 221 GJ24367-PA 70..221 14..168 447 57.4 Plus
Dvir\GJ24345-PA 159 GJ24345-PA 1..154 1..166 377 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15159-PA 170 GK15159-PA 1..170 1..170 670 74.1 Plus
Dwil\GK15160-PA 216 GK15160-PA 53..213 7..169 443 53.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18746-PA 170 GE18746-PA 1..170 1..170 818 90 Plus
Dyak\GE18747-PA 264 GE18747-PA 100..263 5..168 444 53.3 Plus
Dyak\GE18745-PA 158 GE18745-PA 1..153 1..166 387 49.7 Plus

RE70243.hyp Sequence

Translation from 113 to 625

> RE70243.hyp
MTHLTKNFARPEKNEEVVTFGSLDPSVQELLTAAFQVRQRAYVPYSGFKV
GAAFRAKVDGKIFTGCNVENAAFTPGSCAERTAIAKAVSEGATEFLAGAV
LAYEPNVFTTPCGVCRQFIREFANADIPIYVAQAIDARIAEKQELLQSDD
PVMCTSIFNLLPSSFHTYRK*

RE70243.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8353-PB 170 CG8353-PB 1..170 1..170 875 100 Plus
CG8353-PA 170 CG8353-PA 1..170 1..170 875 100 Plus
CG8349-PA 264 CG8349-PA 100..263 5..168 416 51.5 Plus
CG8360-PC 158 CG8360-PC 1..152 1..165 379 49.4 Plus
CG8360-PA 158 CG8360-PA 1..152 1..165 379 49.4 Plus