Clone RE70318 Report

Search the DGRC for RE70318

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:703
Well:18
Vector:pFlc-1
Associated Gene/TranscriptCG1124-RA
Protein status:RE70318.pep: gold
Preliminary Size:1123
Sequenced Size:1129

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1124 2002-01-01 Sim4 clustering to Release 2
CG1124 2002-04-26 Blastp of sequenced clone
CG1124 2003-01-01 Sim4 clustering to Release 3
CG1124 2008-04-29 Release 5.5 accounting
CG1124 2008-08-15 Release 5.9 accounting
CG1124 2008-12-18 5.12 accounting

Clone Sequence Records

RE70318.complete Sequence

1129 bp (1129 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113548

> RE70318.complete
TGGCAGTTTAAGTTCTCAGCTTCGCATCGACGGACGTTCGAGCACTCCAC
CCGCAGAAAGTTGATAGCTTCAGATTCCGACTTCGTTGCGTGCTGCTGCA
GATTGAGATTCATATCCGGAAGTTGTTCTTGAGTGAAATGAATAAAGCGG
TGTGCCTAGTAATCGTGATCCAAGCATTGCGGATGGTGCAGGCCGAGACC
CCGCCCTATATTAAACAATGTCATAGGAACGACCCGAAATTGGTGGACTG
CTTTATCGGAGCTATTGAACACCTAAAGCCATATTTGGCCAATGGCATTC
CTGATATTCAGCTGCCCTCTGTGGAGCCCTTTAAGATGGACACCCTTGCC
CTGCAGTTAACAGAGGGTCCCCAGGGGTATAAGATCACGCTGAAGAACAT
GGAGGCCTTCGGGGCCAGCAACTTCAAGGTGACATCCCTGAAACTGAGCG
AAGGAAGCGAGCCCTTCAAGGCGAAGATCGTGATGCCCAAGCTAAAGATT
GAGGCTAAATACACGAGCTCCGGGGTCCTGCTGATCCTGCCCGCCTCCGG
AGGTGGGGACTTCCATGCTAACTTCGAGGGTGTGAGTGCCGATCTCACAG
GAAAGACATCCATTCACGCCTTCAAGGGCGCTAACTACCTCCACATCGAT
GCTCTCAGCTTGGTTCTGGATGTGAAGGATGTGAAAATGAGCATCTCAGG
TGCCTTCAACAACAATCGAATTCTGCTGGAGGCCACCAATCTGTTTCTGC
GGGAAAACTCTCAAGTCGTTTTGGAGGCTATGCAGGCTCAATTGCAGAAA
AAATTGGCTAGCGAGTTCGGCAAACTCGCCAACCAGCTCCTGAAGAATGT
TCCTGTAGAGCAATTCTACGTGGACTAGGCCTTAATCCCTTAGATTGTAG
TTCGTTAGTCTTATGTATATATATGTATTTAACTCTAAATTACACTCCAA
TGCTATGAACCAAGTATTAAATTGTACATGTATATGGTGTAAACTCTGCG
CATTTGTCTGGGTCAATAATGTCCTAGATTCCGATGATAATAAAACTCAT
AAGTTTAATCATCAATTATTATTATTTGCATTGCGTAGAGTCGTATTCAC
CCTGTGAAATCAATAAAAAAAAAAAAAAA

RE70318.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG1124-RA 1281 CG1124-RA 135..1252 3..1120 5590 100 Plus
CG1124.a 1024 CG1124.a 93..1011 202..1120 4595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 793299..793716 309..726 2090 100 Plus
chr3R 27901430 chr3R 793779..794166 727..1114 1940 100 Plus
chr3R 27901430 chr3R 791130..791328 3..201 995 100 Plus
chr3R 27901430 chr3R 792810..792919 202..311 550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4967618..4968035 309..726 2090 100 Plus
3R 32079331 3R 4968098..4968491 727..1120 1970 100 Plus
3R 32079331 3R 4965449..4965647 3..201 995 100 Plus
3R 32079331 3R 4967129..4967238 202..311 550 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4708449..4708866 309..726 2090 100 Plus
3R 31820162 3R 4708929..4709322 727..1120 1970 100 Plus
3R 31820162 3R 4706280..4706478 3..201 995 100 Plus
3R 31820162 3R 4707960..4708069 202..311 550 100 Plus
Blast to na_te.dros performed 2019-03-16 06:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
G3 4605 G3 G3 4605bp 4516..4583 912..978 112 66.7 Plus

RE70318.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:39:01 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 791128..791328 1..201 99 -> Plus
chr3R 792810..792919 202..311 100 -> Plus
chr3R 793302..793716 312..726 100 -> Plus
chr3R 793779..794166 727..1114 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:36 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 1..741 138..878 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:58 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 1..741 138..878 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:40:35 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 1..741 138..878 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:28 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 1..741 138..878 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:18:54 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 1..741 138..878 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:00 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 1..1114 1..1114 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:58 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 1..1114 1..1114 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:40:35 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 3..1116 1..1114 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:28 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 1..1114 1..1114 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:18:54 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
CG1124-RA 3..1116 1..1114 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:39:01 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4965447..4965647 1..201 99 -> Plus
3R 4967129..4967238 202..311 100 -> Plus
3R 4967621..4968035 312..726 100 -> Plus
3R 4968098..4968485 727..1114 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:39:01 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4965447..4965647 1..201 99 -> Plus
3R 4967129..4967238 202..311 100 -> Plus
3R 4967621..4968035 312..726 100 -> Plus
3R 4968098..4968485 727..1114 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:39:01 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4965447..4965647 1..201 99 -> Plus
3R 4967129..4967238 202..311 100 -> Plus
3R 4967621..4968035 312..726 100 -> Plus
3R 4968098..4968485 727..1114 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:40:35 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 791169..791369 1..201 99 -> Plus
arm_3R 792851..792960 202..311 100 -> Plus
arm_3R 793820..794207 727..1114 100   Plus
arm_3R 793343..793757 312..726 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:06 Download gff for RE70318.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4708452..4708866 312..726 100 -> Plus
3R 4708929..4709316 727..1114 100   Plus
3R 4706278..4706478 1..201 99 -> Plus
3R 4707960..4708069 202..311 100 -> Plus

RE70318.pep Sequence

Translation from 137 to 877

> RE70318.pep
MNKAVCLVIVIQALRMVQAETPPYIKQCHRNDPKLVDCFIGAIEHLKPYL
ANGIPDIQLPSVEPFKMDTLALQLTEGPQGYKITLKNMEAFGASNFKVTS
LKLSEGSEPFKAKIVMPKLKIEAKYTSSGVLLILPASGGGDFHANFEGVS
ADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEAT
NLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFYVD*

RE70318.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18921-PA 246 GF18921-PA 1..246 1..246 1185 90.7 Plus
Dana\GF16078-PA 249 GF16078-PA 1..245 1..243 384 28.6 Plus
Dana\GF16079-PA 246 GF16079-PA 24..244 22..244 313 28.7 Plus
Dana\GF11902-PA 266 GF11902-PA 39..266 20..245 270 28.9 Plus
Dana\GF11323-PA 261 GF11323-PA 31..235 19..223 263 28 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12598-PA 246 GG12598-PA 1..246 1..246 1253 97.6 Plus
Dere\GG11255-PA 249 GG11255-PA 21..245 20..243 381 30.7 Plus
Dere\GG11266-PA 246 GG11266-PA 12..244 5..244 315 27.9 Plus
Dere\GG16974-PA 269 GG16974-PA 42..269 20..245 270 28.5 Plus
Dere\GG20212-PA 259 GG20212-PA 33..238 20..225 248 26.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17330-PA 244 GH17330-PA 11..244 10..246 956 76.1 Plus
Dgri\GH15279-PA 249 GH15279-PA 21..245 20..243 386 32 Plus
Dgri\GH15290-PA 247 GH15290-PA 12..245 5..244 300 27.5 Plus
Dgri\GH18760-PA 268 GH18760-PA 41..268 20..245 257 27.6 Plus
Dgri\GH18842-PA 260 GH18842-PA 33..254 22..243 241 24.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG1124-PA 246 CG1124-PA 1..246 1..246 1243 100 Plus
CG2016-PD 249 CG2016-PD 4..245 3..243 370 29.8 Plus
CG2016-PB 249 CG2016-PB 4..245 3..243 370 29.8 Plus
CG2016-PE 254 CG2016-PE 4..250 3..243 360 29.6 Plus
CG14661-PB 246 CG14661-PB 12..244 5..244 318 28.3 Plus
CG14661-PA 246 CG14661-PA 12..244 5..244 318 28.3 Plus
CG2016-PC 183 CG2016-PC 2..179 67..243 284 30.3 Plus
CG10264-PA 270 CG10264-PA 19..270 4..245 254 26.6 Plus
CG10407-PB 259 CG10407-PB 33..236 20..223 252 27.2 Plus
CG10407-PA 259 CG10407-PA 33..236 20..223 252 27.2 Plus
CG10407-PC 263 CG10407-PC 33..240 20..223 238 26.7 Plus
CG14457-PB 271 CG14457-PB 27..255 20..246 223 23.4 Plus
CG14457-PC 270 CG14457-PC 28..254 22..246 218 23.1 Plus
CG11852-PA 250 CG11852-PA 23..249 22..246 191 24 Plus
CG2650-PA 260 CG2650-PA 30..257 22..244 185 23.8 Plus
CG17189-PC 271 CG17189-PC 25..255 20..246 183 21.2 Plus
CG17189-PB 271 CG17189-PB 25..255 20..246 183 21.2 Plus
CG14259-PA 289 CG14259-PA 40..271 19..246 180 21.6 Plus
to-PB 249 CG11853-PB 3..247 4..246 179 24.7 Plus
to-PA 249 CG11853-PA 3..247 4..246 179 24.7 Plus
CG33680-PA 278 CG33680-PA 15..227 6..244 164 21.5 Plus
CG5945-PB 250 CG5945-PB 28..247 25..243 161 21 Plus
CG5945-PA 250 CG5945-PA 28..247 25..243 161 21 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10251-PA 244 GI10251-PA 1..244 1..246 971 75.8 Plus
Dmoj\GI22504-PA 249 GI22504-PA 1..245 1..243 381 30.2 Plus
Dmoj\GI22505-PA 247 GI22505-PA 24..245 22..244 307 28.3 Plus
Dmoj\GI22650-PA 263 GI22650-PA 36..261 20..243 279 29.2 Plus
Dmoj\GI21174-PA 307 GI21174-PA 5..223 25..244 233 24.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21627-PA 246 GL21627-PA 1..246 1..246 1164 89 Plus
Dper\GL22211-PA 249 GL22211-PA 21..245 20..243 382 30.7 Plus
Dper\GL22212-PA 266 GL22212-PA 21..233 19..233 312 30.2 Plus
Dper\GL12216-PA 269 GL12216-PA 42..269 20..245 273 28.9 Plus
Dper\GL17654-PA 262 GL17654-PA 3..221 25..244 249 26.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10858-PA 246 GA10858-PA 1..246 1..246 1164 89 Plus
Dpse\GA15186-PA 249 GA15186-PA 21..245 20..243 382 30.7 Plus
Dpse\GA13156-PA 246 GA13156-PA 21..244 19..244 322 29.2 Plus
Dpse\GA10203-PA 269 GA10203-PA 42..269 20..245 274 28.9 Plus
Dpse\GA10301-PA 265 GA10301-PA 34..239 18..223 209 24.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10785-PA 246 GM10785-PA 1..246 1..246 1275 98.8 Plus
Dsec\GM10667-PA 249 GM10667-PA 1..245 1..243 376 29 Plus
Dsec\GM10668-PA 246 GM10668-PA 12..244 5..244 318 28.3 Plus
Dsec\GM24280-PA 270 GM24280-PA 43..270 20..245 272 28.5 Plus
Dsec\GM25738-PA 230 GM25738-PA 4..209 20..225 256 27.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19757-PA 246 GD19757-PA 1..246 1..246 1275 98.8 Plus
Dsim\GD19644-PA 246 GD19644-PA 12..244 5..244 318 28.3 Plus
Dsim\GD19070-PA 270 GD19070-PA 43..270 20..245 271 28.5 Plus
Dsim\GD15043-PA 271 GD15043-PA 14..255 4..246 220 23.5 Plus
Dsim\GD21189-PA 250 GD21189-PA 23..249 22..246 188 24.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11056-PA 244 GJ11056-PA 1..242 1..244 987 76.8 Plus
Dvir\GJ10107-PA 249 GJ10107-PA 7..245 7..243 382 30.1 Plus
Dvir\GJ10108-PA 247 GJ10108-PA 24..245 22..244 308 28.3 Plus
Dvir\GJ23379-PA 264 GJ23379-PA 37..262 20..243 281 29.2 Plus
Dvir\GJ23840-PA 260 GJ23840-PA 30..235 19..224 242 26.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13242-PA 246 GK13242-PA 1..246 1..246 1107 84.1 Plus
Dwil\GK14050-PA 251 GK14050-PA 23..247 20..243 374 30.7 Plus
Dwil\GK14051-PA 224 GK14051-PA 2..222 22..244 271 26.5 Plus
Dwil\GK13256-PA 268 GK13256-PA 41..268 20..245 262 28.1 Plus
Dwil\GK14019-PA 258 GK14019-PA 28..233 19..224 222 25 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25446-PA 246 GE25446-PA 1..246 1..246 1246 96.3 Plus
Dyak\GE25317-PA 249 GE25317-PA 1..245 1..243 378 29 Plus
Dyak\GE25321-PA 246 GE25321-PA 12..244 5..244 308 27.5 Plus
Dyak\GE25318-PA 246 GE25318-PA 12..244 5..244 308 27.5 Plus
Dyak\GE24362-PA 269 GE24362-PA 42..269 20..245 272 28.5 Plus

RE70318.hyp Sequence

Translation from 137 to 877

> RE70318.hyp
MNKAVCLVIVIQALRMVQAETPPYIKQCHRNDPKLVDCFIGAIEHLKPYL
ANGIPDIQLPSVEPFKMDTLALQLTEGPQGYKITLKNMEAFGASNFKVTS
LKLSEGSEPFKAKIVMPKLKIEAKYTSSGVLLILPASGGGDFHANFEGVS
ADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNNNRILLEAT
NLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFYVD*

RE70318.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG1124-PA 246 CG1124-PA 1..246 1..246 1243 100 Plus
CG2016-PD 249 CG2016-PD 4..245 3..243 370 29.8 Plus
CG2016-PB 249 CG2016-PB 4..245 3..243 370 29.8 Plus
CG2016-PE 254 CG2016-PE 4..250 3..243 360 29.6 Plus
CG14661-PB 246 CG14661-PB 12..244 5..244 318 28.3 Plus