Clone RE70417 Report

Search the DGRC for RE70417

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:704
Well:17
Vector:pFlc-1
Associated Gene/Transcriptwun-RB
Protein status:RE70417.pep: gold
Preliminary Size:1584
Sequenced Size:2039

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8804 2002-10-18 Blastp of sequenced clone
wun 2008-04-29 Release 5.5 accounting
wun 2008-08-15 Release 5.9 accounting
wun 2008-12-18 5.12 accounting

Clone Sequence Records

RE70417.complete Sequence

2039 bp (2039 high quality bases) assembled on 2002-10-18

GenBank Submission: BT001729

> RE70417.complete
AGTCGCCTTTTTCCATTGGACGAGTTCGGTTCAAATGCTCTGTGTCGCTC
GTTCATTCGACCAAAATAAAGTGCGTGTAGAAAATCGGGCGTATATATGT
ACATATAACCCTTATCCGATTGACACTGATCGAATCCGAGAGTCAGAAAA
GCGTACGTTACATAAAGGCCAAAACGATGACGGAGCAGTAAAGGCTTGCC
TGAAAATCTTTCGCAACGCTGCTGCTCGGGTTTAAGTACTGAAGAGATGA
CATGACGTAAAACCAGATTCAGAAAGCTCAAGTTCACTGCCAAGCAGAGT
AACTTCAAGAGAAAGCAAAGGAAGTGAGAGCGCAAAAGCTTGAGATTGAG
CTTGGAGCTTTTGCAACGGCACCCACAAAATGCCAGCCGTGAAAATAATA
ATGAGTACCGAAACGTCGGCGAGCGAGACAACACCGCTGCGGCGGTCGGA
AAACGAAACACCTGACCATAAAGAACTGGCCCAAAGTAACAGCAACAGTC
GACAAACAACAGTTAATAGCAACAACAATAACTACAGTAACTCGGTGCAA
GTGCGTCTGCAGGAACAGGACAGAGATAGCGACAGCGAGCAACAACAACA
TACTGCCACCATCACCATGGATACCAACAAAAGAATCCTCTGCCGCGTGG
GCTTGGATGTTTTAATCTTGCTCTGCGCTGGATTTCCCATACTGCTGTTT
TTCCTGCTGGGCGAGCCGTACAAGCGGGGCTTCTTCTGCGATGACGAGTC
ACTGAAGCACCCGTTCCACGATTCTACGGTCCGGAATTGGATGCTATACT
TCATCGGAGCTGTGATACCAGTCGGCGTGATATTCATCGTGGAGGTCATC
ATTTCACAGAACAAGGCCAAGCAGGATAATGGCAATGCAACCAGTCGAAG
GTACGTCTTTATGAACTACGAACTGCCCGACTGGATGATCGAGTGCTACA
AGAAGATCGGCATCTATGCCTTCGGCGCTGTGCTCAGCCAGCTGACCACG
GATATAGCCAAGTACTCCATCGGCCGACTGCGTCCCCATTTCATCGCGGT
GTGCCAGCCTCAAATGGCCGACGGCAGCACCTGCGACGATGCGATCAATG
CGGGAAAATACATCCAGGAGTTCACATGCAAGGGAGTTGGATCGTCGGCG
CGCATGCTCAAAGAGATGCGCCTCTCCTTCCCCAGTGGCCACTCCAGCTT
CACCTTCTTCGCCATGGTCTATCTGGCGCTCTACCTGCAGGCTCGCATGA
CCTGGCGGGGCTCCAAGCTGCTGCGTCACCTTCTCCAGTTCCTGTTCATC
ATGGTGGCCTGGTACACAGCCCTAAGTCGCGTATCGGACTACAAGCACCA
CTGGTCCGATGTGCTGGCAGGATCGCTTATTGGCTCCATAAGCGCACTGG
TCGTGGCCAACTATGTCTCCGACTTGTTTCAAAAGCCCAACACGAAGCCC
TATTTGGCGCGTACAGTGCAAGACATGAATGCATCGCCGGCCCAGGCCAT
AACGATTACTACAAACTAACACGCAGAAGTGCAAAATAGCAATTACAAGT
TGCACGAGCTGTAGTTAAACTAAGGACTCGATGTTCTTACGGCTTTCTTC
ATGGGGACAGTGAAGCCTAGCTTTGCGAGCCTTCCCAATTAATTTATTCC
TGTACTGGCATTTTAAGAGCTGAGCGTGAATGTATGTGTTAGCTGCAAGT
GCACTCGAGTGCCTTCTTTAATATTTAAACTAGAGCAATTGAGAGATCTG
TGTATGACGATAGCTATACTAAATATTTTTAACTGACGCAACAATTTCCA
CAAAACAAGTGACCTTTAAAACAGAGCTACGCAAAAAATATATGAAAGCA
ATAAGTATTATGTAAACTAGTTTTAAGCTTTGGATACGGAAAGATAATTA
AAATATTTCTAAGATGGCCGTTAAATATGTTAATTTATAATTTTTGGCGA
GAATTTACAATTGTTCGCTGAATATTTTTATGAAAATAAAATAGAATTAA
GAATATGGTTTTGTTATTTGTAGCAAAAAAAAAAAAAAA

RE70417.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
wun-RB 2131 wun-RB 55..2083 1..2029 10115 99.9 Plus
wun.a 1751 wun.a 1..1751 257..2007 8740 99.9 Plus
wun-RA 1594 wun-RA 1..1594 414..2007 7955 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5288019..5288637 2023..1405 3080 99.8 Minus
chr2R 21145070 chr2R 5296701..5297143 677..235 2200 99.8 Minus
chr2R 21145070 chr2R 5300721..5300956 236..1 1180 100 Minus
chr2R 21145070 chr2R 5291193..5291414 1050..829 1095 99.5 Minus
chr2R 21145070 chr2R 5290144..5290324 1228..1048 905 100 Minus
chr2R 21145070 chr2R 5289896..5290074 1406..1228 895 100 Minus
chr2R 21145070 chr2R 5291795..5291947 829..677 765 100 Minus
chr3L 24539361 chr3L 22461741..22461956 1169..1384 210 73.1 Plus
chr2R 21145070 chr2R 5304930..5305035 1269..1374 200 79.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9400525..9401149 2029..1405 3095 99.7 Minus
2R 25286936 2R 9409213..9409655 677..235 2215 100 Minus
2R 25286936 2R 9413225..9413460 236..1 1180 100 Minus
2R 25286936 2R 9403705..9403926 1050..829 1110 100 Minus
2R 25286936 2R 9402656..9402836 1228..1048 905 100 Minus
2R 25286936 2R 9402408..9402586 1406..1228 895 100 Minus
2R 25286936 2R 9404307..9404459 829..677 765 100 Minus
3L 28110227 3L 22472833..22473048 1169..1384 210 73.1 Plus
2R 25286936 2R 9417435..9417540 1269..1374 200 79.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9401724..9402348 2029..1405 3095 99.6 Minus
2R 25260384 2R 9410412..9410854 677..235 2215 100 Minus
2R 25260384 2R 9414424..9414659 236..1 1180 100 Minus
2R 25260384 2R 9404904..9405125 1050..829 1110 100 Minus
2R 25260384 2R 9403855..9404035 1228..1048 905 100 Minus
2R 25260384 2R 9403607..9403785 1406..1228 895 100 Minus
2R 25260384 2R 9405506..9405658 829..677 765 100 Minus
2R 25260384 2R 9418634..9418739 1269..1374 200 79.2 Plus
Blast to na_te.dros performed 2019-03-15 14:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2371..2514 485..637 138 61.9 Plus
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 5897..5941 1719..1763 116 78.3 Plus

RE70417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:30:24 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5300721..5300956 1..236 100   Minus
chr2R 5288018..5288636 1406..2024 99 <- Minus
chr2R 5289897..5290073 1229..1405 100 <- Minus
chr2R 5290144..5290323 1049..1228 100 <- Minus
chr2R 5291195..5291413 830..1048 99 <- Minus
chr2R 5291795..5291946 678..829 100 <- Minus
chr2R 5296701..5297141 237..677 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:16:46 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 1..1140 380..1519 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:06:09 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 1..1140 380..1519 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:31:02 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 1..1140 380..1519 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:56:02 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 1..1140 380..1519 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:00:11 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 1..1140 380..1519 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:16:46 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 1..2007 1..2007 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:06:09 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 1..2007 1..2007 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:31:02 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 4..2026 1..2023 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:56:02 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 1..2007 1..2007 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:00:11 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
wun-RB 4..2026 1..2023 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:30:24 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9403707..9403925 830..1048 100 <- Minus
2R 9404307..9404458 678..829 100 <- Minus
2R 9400530..9401148 1406..2024 99 <- Minus
2R 9402409..9402585 1229..1405 100 <- Minus
2R 9402656..9402835 1049..1228 100 <- Minus
2R 9409213..9409653 237..677 100 <- Minus
2R 9413225..9413460 1..236 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:30:24 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9403707..9403925 830..1048 100 <- Minus
2R 9404307..9404458 678..829 100 <- Minus
2R 9400530..9401148 1406..2024 99 <- Minus
2R 9402409..9402585 1229..1405 100 <- Minus
2R 9402656..9402835 1049..1228 100 <- Minus
2R 9409213..9409653 237..677 100 <- Minus
2R 9413225..9413460 1..236 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:30:24 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9403707..9403925 830..1048 100 <- Minus
2R 9404307..9404458 678..829 100 <- Minus
2R 9400530..9401148 1406..2024 99 <- Minus
2R 9402409..9402585 1229..1405 100 <- Minus
2R 9402656..9402835 1049..1228 100 <- Minus
2R 9409213..9409653 237..677 100 <- Minus
2R 9413225..9413460 1..236 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:31:02 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5288035..5288653 1406..2024 99 <- Minus
arm_2R 5289914..5290090 1229..1405 100 <- Minus
arm_2R 5290161..5290340 1049..1228 100 <- Minus
arm_2R 5291212..5291430 830..1048 100 <- Minus
arm_2R 5291812..5291963 678..829 100 <- Minus
arm_2R 5296718..5297158 237..677 100 <- Minus
arm_2R 5300730..5300965 1..236 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:28:26 Download gff for RE70417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9414424..9414659 1..236 100   Minus
2R 9410412..9410852 237..677 100 <- Minus
2R 9401729..9402347 1406..2024 99 <- Minus
2R 9403608..9403784 1229..1405 100 <- Minus
2R 9403855..9404034 1049..1228 100 <- Minus
2R 9404906..9405124 830..1048 100 <- Minus
2R 9405506..9405657 678..829 100 <- Minus

RE70417.pep Sequence

Translation from 379 to 1518

> RE70417.pep
MPAVKIIMSTETSASETTPLRRSENETPDHKELAQSNSNSRQTTVNSNNN
NYSNSVQVRLQEQDRDSDSEQQQHTATITMDTNKRILCRVGLDVLILLCA
GFPILLFFLLGEPYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVGV
IFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGA
VLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTC
KGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRH
LLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVSDLF
QKPNTKPYLARTVQDMNASPAQAITITTN*

RE70417.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13080-PA 377 GF13080-PA 1..377 8..379 1595 79.9 Plus
Dana\GF11822-PA 347 GF11822-PA 56..344 56..344 780 50.2 Plus
Dana\GF10980-PA 345 GF10980-PA 62..297 112..353 639 47.9 Plus
Dana\GF10978-PA 335 GF10978-PA 7..275 87..370 577 42 Plus
Dana\GF23463-PA 331 GF23463-PA 4..226 114..352 464 39.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10557-PA 372 GG10557-PA 1..372 8..379 1789 88.6 Plus
Dere\GG23436-PA 351 GG23436-PA 8..348 13..344 743 44.7 Plus
Dere\GG16258-PA 340 GG16258-PA 51..292 103..350 613 46.4 Plus
Dere\GG16256-PA 341 GG16256-PA 9..289 85..370 564 40.1 Plus
Dere\GG16259-PA 305 GG16259-PA 35..254 111..342 474 41.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21309-PA 380 GH21309-PA 1..380 8..379 1321 65.1 Plus
Dgri\GH20575-PA 365 GH20575-PA 104..365 86..344 756 55.7 Plus
Dgri\GH16694-PA 345 GH16694-PA 2..301 41..356 684 42.1 Plus
Dgri\GH16692-PA 348 GH16692-PA 7..278 87..363 570 41.3 Plus
Dgri\GH14815-PA 385 GH14815-PA 4..226 114..351 473 40.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
wun-PB 379 CG8804-PB 1..379 1..379 1969 100 Plus
wun-PC 364 CG8804-PC 1..343 1..343 1781 99.7 Plus
wun-PA 300 CG8804-PA 1..300 80..379 1573 100 Plus
wun2-PA 350 CG8805-PA 8..347 13..344 799 45.6 Plus
wun2-PB 246 CG8805-PB 1..243 104..344 716 54.3 Plus
CG11426-PA 340 CG11426-PA 30..292 82..350 651 43.9 Plus
CG11438-PB 341 CG11438-PB 7..287 87..370 577 41.5 Plus
CG11438-PA 341 CG11438-PA 7..287 87..370 577 41.5 Plus
laza-PA 334 CG11440-PA 4..226 114..352 483 40.9 Plus
CG11425-PA 305 CG11425-PA 20..254 92..342 453 38.9 Plus
CG11437-PA 305 CG11437-PA 6..281 83..356 384 33.3 Plus
CG12746-PE 363 CG12746-PE 158..298 202..347 184 32.5 Plus
CG12746-PD 363 CG12746-PD 158..298 202..347 184 32.5 Plus
CG12746-PB 363 CG12746-PB 158..298 202..347 184 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19743-PA 298 GI19743-PA 1..298 80..379 1294 77.4 Plus
Dmoj\GI19768-PA 375 GI19768-PA 113..372 86..344 744 50.4 Plus
Dmoj\GI11383-PA 345 GI11383-PA 6..300 48..353 657 41.2 Plus
Dmoj\GI11380-PA 340 GI11380-PA 7..295 87..379 575 40.7 Plus
Dmoj\GI13921-PA 361 GI13921-PA 4..234 114..363 501 40.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16886-PA 306 GL16886-PA 1..306 80..379 1439 85 Plus
Dper\GL17588-PA 372 GL17588-PA 105..369 84..344 771 52.1 Plus
Dper\GL23165-PA 343 GL23165-PA 51..295 103..353 619 45 Plus
Dper\GL23143-PA 328 GL23143-PA 7..272 87..370 509 39.5 Plus
Dper\GL23176-PA 274 GL23176-PA 2..206 127..342 386 41 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21332-PA 386 GA21332-PA 1..386 8..379 1487 74 Plus
Dpse\GA21332-PC 306 GA21332-PC 1..306 80..379 1436 84.6 Plus
Dpse\GA21332-PB 365 GA21332-PB 1..344 8..343 1355 75.1 Plus
Dpse\GA24835-PA 369 GA24835-PA 102..366 84..344 771 52.1 Plus
Dpse\GA10999-PA 343 GA10999-PA 51..295 103..353 619 45 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20603-PA 372 GM20603-PA 1..372 8..379 1960 96.5 Plus
Dsec\GM21120-PA 350 GM21120-PA 1..347 8..344 748 46.1 Plus
Dsec\GM22448-PA 340 GM22448-PA 51..292 103..350 661 46.8 Plus
Dsec\GM22445-PA 341 GM22445-PA 9..287 85..370 575 40.2 Plus
Dsec\GM22093-PA 337 GM22093-PA 4..226 114..352 484 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10076-PA 372 GD10076-PA 1..372 8..379 1957 96.5 Plus
Dsim\GD10653-PA 350 GD10653-PA 1..347 8..344 753 46.7 Plus
Dsim\GD15031-PA 340 GD15031-PA 51..292 103..350 666 47.2 Plus
Dsim\GD15029-PA 341 GD15029-PA 7..287 87..370 569 39.6 Plus
Dsim\GD12067-PA 343 GD12067-PA 4..226 114..352 484 41.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18026-PA 378 GJ18026-PA 1..378 8..379 1359 66.9 Plus
Dvir\GJ18273-PA 332 GJ18273-PA 46..312 77..342 749 55.2 Plus
Dvir\GJ11638-PA 337 GJ11638-PA 27..291 83..353 680 43.9 Plus
Dvir\GJ11635-PA 345 GJ11635-PA 30..299 110..379 593 42.6 Plus
Dvir\GJ13711-PA 340 GJ13711-PA 4..225 114..351 497 41.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21745-PA 385 GK21745-PA 1..385 8..379 1385 68.4 Plus
Dwil\GK21557-PA 361 GK21557-PA 8..358 13..344 780 47 Plus
Dwil\GK16761-PA 362 GK16761-PA 38..310 58..351 678 43.2 Plus
Dwil\GK16759-PA 364 GK16759-PA 7..276 87..350 560 42.6 Plus
Dwil\GK17452-PA 349 GK17452-PA 4..225 114..351 508 40.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22302-PA 369 GE22302-PA 1..369 8..379 1787 90.9 Plus
Dyak\GE19275-PA 354 GE19275-PA 47..351 44..344 748 48.2 Plus
Dyak\GE23019-PA 340 GE23019-PA 51..293 103..351 617 45 Plus
Dyak\GE19506-PA 340 GE19506-PA 51..292 103..350 614 45.2 Plus
Dyak\GE23017-PA 341 GE23017-PA 7..287 87..370 567 40.3 Plus

RE70417.hyp Sequence

Translation from 379 to 1518

> RE70417.hyp
MPAVKIIMSTETSASETTPLRRSENETPDHKELAQSNSNSRQTTVNSNNN
NYSNSVQVRLQEQDRDSDSEQQQHTATITMDTNKRILCRVGLDVLILLCA
GFPILLFFLLGEPYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVGV
IFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGA
VLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTC
KGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRH
LLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVSDLF
QKPNTKPYLARTVQDMNASPAQAITITTN*

RE70417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
wun-PB 379 CG8804-PB 1..379 1..379 1969 100 Plus
wun-PC 364 CG8804-PC 1..343 1..343 1781 99.7 Plus
wun-PA 300 CG8804-PA 1..300 80..379 1573 100 Plus
wun2-PA 350 CG8805-PA 8..347 13..344 799 45.6 Plus
wun2-PB 246 CG8805-PB 1..243 104..344 716 54.3 Plus