Clone RE70528 Report

Search the DGRC for RE70528

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:705
Well:28
Vector:pFlc-1
Associated Gene/TranscriptCG13640-RA
Protein status:RE70528.pep: gold
Preliminary Size:399
Sequenced Size:519

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13640 2002-01-01 Sim4 clustering to Release 2
CG13640 2002-06-03 Blastp of sequenced clone
CG13640 2003-01-01 Sim4 clustering to Release 3
CG13640 2008-04-29 Release 5.5 accounting
CG13640 2008-08-15 Release 5.9 accounting
CG13640 2008-12-18 5.12 accounting

Clone Sequence Records

RE70528.complete Sequence

519 bp (519 high quality bases) assembled on 2002-06-03

GenBank Submission: AY118415

> RE70528.complete
AGAACTGGAAGTGATTCGAAATCGAAGCAAGATGAGATCCCGCGATTCCC
GATTGACTATCCTAACATTGCTGATTGCGTGCTGCCTGGATTCGAGTGGC
GCTCTGTTCTTCAAGTCCTGGAAGACGGGAAAAGGATATACTGGATATAG
TGGAGTACAAGACTATGGAGGCTACGGTCAGGGAAACTACGGCTATGGAA
GCTATGCTGGAGGATATGGTTACAACTATCCCGCATATAATTCCTACTCT
TACCCAGCTTACTCAGGCCACTCCTCTTACTCATACTCCAAAGGAGGACG
CAAGCCTTCTGGAAACCGCAAAGGACGCACTTACTCGGACATTCGAAGAG
TTATAAATCCCGATCCATACATCGGTCCTGGAGGCAGTCGCTTCCTGCCC
CGTACTCCATATTCCGCCCTTTGGGGTTAACGATTCGACCGTCTGAACTC
GCATTGTTGTCAGCAGTATTAGCCATTAAAATAAAATCAGCGAAAGTTAC
ATCTAAAAAAAAAGAAAAA

RE70528.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13640-RA 504 CG13640-RA 1..504 1..504 2520 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20684843..20685348 506..1 2530 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:14:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24861657..24862162 506..1 2530 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24602488..24602993 506..1 2530 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:47:58 has no hits.

RE70528.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:48:44 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20684836..20685348 1..514 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:34:49 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 1..399 32..430 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:39:58 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 1..399 32..430 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:49:21 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 1..399 32..430 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:36 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 1..399 32..430 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:15:13 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 1..399 32..430 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:16 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 1..512 1..512 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:39:58 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 1..504 1..504 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:49:21 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 4..507 1..504 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:36 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 1..512 1..512 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:15:13 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13640-RA 4..507 1..504 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:44 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24861650..24862162 1..514 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:44 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24861650..24862162 1..514 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:44 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24861650..24862162 1..514 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:49:21 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20687372..20687884 1..514 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:36 Download gff for RE70528.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24602481..24602993 1..514 99   Minus

RE70528.hyp Sequence

Translation from 0 to 429

> RE70528.hyp
ELEVIRNRSKMRSRDSRLTILTLLIACCLDSSGALFFKSWKTGKGYTGYS
GVQDYGGYGQGNYGYGSYAGGYGYNYPAYNSYSYPAYSGHSSYSYSKGGR
KPSGNRKGRTYSDIRRVINPDPYIGPGGSRFLPRTPYSALWG*

RE70528.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13640-PA 132 CG13640-PA 1..132 11..142 734 100 Plus

RE70528.pep Sequence

Translation from 31 to 429

> RE70528.pep
MRSRDSRLTILTLLIACCLDSSGALFFKSWKTGKGYTGYSGVQDYGGYGQ
GNYGYGSYAGGYGYNYPAYNSYSYPAYSGHSSYSYSKGGRKPSGNRKGRT
YSDIRRVINPDPYIGPGGSRFLPRTPYSALWG*

RE70528.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19930-PA 140 GF19930-PA 1..140 1..132 318 49 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12309-PA 135 GG12309-PA 1..135 1..132 432 74.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13640-PA 132 CG13640-PA 1..132 1..132 734 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22197-PA 140 GI22197-PA 98..140 90..132 134 60.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13557-PA 133 GL13557-PA 1..133 1..132 226 49.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12428-PA 133 GA12428-PA 1..133 1..132 230 52.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23451-PA 136 GM23451-PA 1..136 1..132 451 85.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18257-PA 136 GD18257-PA 1..136 1..132 475 83.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24316-PA 130 GJ24316-PA 6..130 8..132 146 38.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22756-PA 227 GK22756-PA 1..112 1..132 175 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10764-PA 135 GE10764-PA 1..135 1..132 255 59.3 Plus