Clone RE70710 Report

Search the DGRC for RE70710

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:707
Well:10
Vector:pFlc-1
Associated Gene/TranscriptVha14-1-RA
Protein status:RE70710.pep: gold
Sequenced Size:671

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8210 2003-01-01 Sim4 clustering to Release 3
Vha14 2008-04-29 Stopped prior to 5.5

Clone Sequence Records

RE70710.complete Sequence

671 bp assembled on 2009-06-08

GenBank Submission: BT088780.1

> RE70710.complete
GTGTGATAGAGACCAGCTGACCCGTACATTTTCCAGAGTTAGGTTTTAAT
TTCGCTGTCCACATCGCTCGTAAGAAAAAATTAGAAAAAACCAATCGAAA
TGGCTCTGCACTCGGCAATCAAGGGAAAACTGATCAGCGTTATCGGCGAC
GAGGACACCTGTGTGGGCTTTCTGCTCGGCGGAGTGGGCGAGATCAACAA
GAATCGCCATCCCAACTTTATGGTGGTCGACAAAAATACGGCCGTCAGCG
AACTGGAGGACTGTTTCAAGCGTTTCCTTAAGCGGGACGATATCGACATC
ATTCTAATCAACCAGAACTGCGCCGAGCTTATTCGTCATGTGATCGATGC
CCATACGTCGCCCGTGCCCGCTGTTTTGGAGATTCCCTCCAAGGACCATC
CGTACGACGCCAGCAAGGACTCCATTCTGCGTCGCGCCCGCGGCATGTTC
AATCCGGAGGATCTGGTGCGCTAATTCCTCGAATTCTGCTCGAGGACACT
GTTTCGTATTGCTGCAACCGCCAGAGAATTGCTTTACACCCTGTAAACAA
CTATCCATAGATTCAGTGCTTCGCCTTTGTTCTTATCGTGTATTTAAAGA
CATTTATTAAATGGTTTTCGTTGTATAAATAGATTAAAATCAAATTGTTC
CAAACCAAAAAAAAAAAAAAA

RE70710.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
Vha14-RA 655 Vha14-RA 1..653 2..654 3265 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11566609..11567261 654..2 3220 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:14:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15679423..15680080 659..2 3275 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15680622..15681279 659..2 3275 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 18:53:17 has no hits.

RE70710.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:54:29 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11566607..11567261 1..656 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:07 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-RA 1..375 100..474 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:07 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 1..375 100..474 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:34:19 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 1..375 100..474 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:03:25 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 1..375 100..474 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 16:06:56 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-RA 1..655 2..656 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:07 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 1..655 2..656 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:34:19 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 4..659 1..656 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:03:25 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 4..659 1..656 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:29 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15679426..15680080 1..656 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:29 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15679426..15680080 1..656 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:29 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15679426..15680080 1..656 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:34:19 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11566931..11567585 1..656 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:33 Download gff for RE70710.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15680625..15681279 1..656 99   Minus

RE70710.pep Sequence

Translation from 99 to 473

> RE70710.pep
MALHSAIKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVS
ELEDCFKRFLKRDDIDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDH
PYDASKDSILRRARGMFNPEDLVR*

RE70710.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13376-PA 124 GF13376-PA 1..124 1..124 644 99.2 Plus
Dana\GF16369-PA 156 GF16369-PA 1..113 1..113 407 65.5 Plus
Dana\GF20878-PA 177 GF20878-PA 70..156 12..99 140 27.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22339-PA 124 GG22339-PA 1..124 1..124 647 100 Plus
Dere\GG13113-PA 124 GG13113-PA 1..118 1..118 384 59.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22329-PA 124 GH22329-PA 1..124 1..124 631 97.6 Plus
Dgri\GH14013-PA 113 GH14013-PA 1..108 12..119 370 63 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Vha14-1-PA 124 CG8210-PA 1..124 1..124 644 100 Plus
Vha14-2-PC 124 CG1076-PC 1..121 1..121 387 57.9 Plus
Vha14-2-PB 124 CG1076-PB 1..121 1..121 387 57.9 Plus
Vha14-2-PA 129 CG1076-PA 51..126 46..121 231 56.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23969-PA 124 GI23969-PA 1..124 1..124 631 97.6 Plus
Dmoj\GI24384-PA 123 GI24384-PA 9..114 9..114 387 66 Plus
Dmoj\GI16267-PA 146 GI16267-PA 37..122 12..98 134 32.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11862-PA 124 GL11862-PA 1..124 1..124 641 99.2 Plus
Dper\GL24046-PA 102 GL24046-PA 9..97 31..119 267 53.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Vha14-PA 124 GA20901-PA 1..124 1..124 641 99.2 Plus
Dpse\GA26491-PA 124 GA26491-PA 1..119 1..119 398 59.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20126-PA 124 GM20126-PA 1..124 1..124 647 100 Plus
Dsec\GM10855-PA 124 GM10855-PA 1..121 1..121 386 57 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25605-PA 124 GD25605-PA 1..124 1..124 647 100 Plus
Dsim\GD19837-PA 124 GD19837-PA 1..119 1..119 390 58 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22513-PA 124 GJ22513-PA 1..124 1..124 629 96.8 Plus
Dvir\GJ10919-PA 124 GJ10919-PA 1..124 1..124 628 96 Plus
Dvir\GJ14239-PA 137 GJ14239-PA 1..113 1..113 384 61.9 Plus
Dvir\GJ16910-PA 146 GJ16910-PA 38..134 12..107 143 34.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12172-PA 124 GK12172-PA 1..124 1..124 634 97.6 Plus
Dwil\GK13026-PA 144 GK13026-PA 1..117 1..117 390 62.4 Plus
Dwil\GK21017-PA 235 GK21017-PA 13..113 11..111 355 66.3 Plus
Dwil\GK25730-PA 170 GK25730-PA 62..165 12..114 135 25.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14140-PA 124 GE14140-PA 1..124 1..124 647 100 Plus
Dyak\GE10180-PA 124 GE10180-PA 1..119 1..119 379 56.3 Plus

RE70710.hyp Sequence

Translation from 99 to 473

> RE70710.hyp
MALHSAIKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVS
ELEDCFKRFLKRDDIDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDH
PYDASKDSILRRARGMFNPEDLVR*

RE70710.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
Vha14-1-PA 124 CG8210-PA 1..124 1..124 644 100 Plus
Vha14-2-PC 124 CG1076-PC 1..121 1..121 387 57.9 Plus
Vha14-2-PB 124 CG1076-PB 1..121 1..121 387 57.9 Plus
Vha14-2-PA 129 CG1076-PA 51..126 46..121 231 56.6 Plus