Clone RE70889 Report

Search the DGRC for RE70889

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:708
Well:89
Vector:pFlc-1
Associated Gene/TranscriptGstD4-RA
Protein status:RE70889.pep: gold
Preliminary Size:678
Sequenced Size:740

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11512 2001-12-17 Blastp of sequenced clone
CG11512 2002-01-01 Sim4 clustering to Release 2
CG11512 2003-01-01 Sim4 clustering to Release 3
GstD4 2008-04-29 Release 5.5 accounting
GstD4 2008-08-15 Release 5.9 accounting
GstD4 2008-12-18 5.12 accounting

Clone Sequence Records

RE70889.complete Sequence

740 bp (740 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071648

> RE70889.complete
AGTTTTGCTCTTCCGCTTCAGCGAATAGGCAACCGTAATCGCCCCAGCAA
CATGGATTTCTACTACTCCCCTCGAAGCAGTGGATCCCGCACCATTATCA
TGGTTGCCAAAGCTCTTGGACTGGAACTGAACAAAAAGCAACTGCGTATC
ACAGAAGGGGAACACCTCAAGCCAGAATTCCTTAAGCTCAATCCCCAGCA
CACCATTCCCACGCTGGTGGACAATGGATTCGCCATTTGGGAGTCCCGTG
CCATAGCCGTCTATCTGGTGGAAAAGTACGGCAAGGACGACTCCCTTTTT
CCCAATGATCCCCAGAAACGCGCATTGATCAATCAGCGATTGTACTTCGA
TATGGGAACCCTGCATGACTCCTTTATGAAGTACTATTACCCATTCATCC
GTACTGGTCAGCTTGGGAATGCCGAGAATTATAAGAAGGTCGAAGCTGCC
TTTGAATTCCTGGACATTTTCTTGGAGGGCCAGGACTACGTGGCTGGTAG
CCAGCTAACTGTGGCCGACATCGCCATCCTCTCCAGCGTTTCCACTTTCG
AAGTGGTTGAGTTTGACATCAGCAAGTATCCAAATGTGGCACGTTGGTAC
GCCAATGCCAAAAAGATCACACCCGGATGGGATGAAAACTGGAAGGGTCT
GCTACAAATGAAAACAATGTACGAAGCCCAAAAGGCCTCATTAAAGTAAC
TACAGTTTTTATAAACTTATATGAAAAAAAAAAAAAAAAA

RE70889.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
GstD4-RA 723 GstD4-RA 1..723 1..723 3615 100 Plus
GstD2-RA 734 GstD2-RA 58..339 82..363 675 82.6 Plus
GstD2-RA 734 GstD2-RA 416..623 440..647 380 78.8 Plus
GstD3-RA 746 GstD3-RA 118..318 155..355 345 78.1 Plus
GstD3-RA 746 GstD3-RA 432..605 469..642 330 79.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8199488..8200210 1..723 3615 100 Plus
chr3R 27901430 chr3R 8197405..8197970 82..647 940 77.7 Plus
chr3R 27901430 chr3R 8201290..8201741 197..648 775 78.1 Plus
chr3R 27901430 chr3R 8204054..8204465 169..577 525 75.7 Plus
chr3R 27901430 chr3R 8198572..8199059 155..642 490 73.4 Plus
chr3R 27901430 chr3R 8193634..8193834 363..163 480 82.6 Minus
chr3R 27901430 chr3R 8190329..8190804 642..167 340 71.4 Minus
chr3R 27901430 chr3R 8205453..8205729 87..363 320 74.4 Plus
chr3R 27901430 chr3R 8191972..8192154 351..169 300 77.6 Minus
chr3R 27901430 chr3R 8202697..8202864 196..363 300 78.6 Plus
chr3R 27901430 chr3R 8193355..8193564 642..433 225 73.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:14:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12374102..12374833 1..732 3660 100 Plus
3R 32079331 3R 12372028..12372593 82..647 940 77.7 Plus
3R 32079331 3R 12375764..12376360 52..648 885 76.5 Plus
3R 32079331 3R 12378672..12379083 169..577 525 75.7 Plus
3R 32079331 3R 12373185..12373672 155..642 490 73.4 Plus
3R 32079331 3R 12368257..12368457 363..163 480 82.6 Minus
3R 32079331 3R 12364952..12365427 642..167 355 71.6 Minus
3R 32079331 3R 12380071..12380347 87..363 320 74.4 Plus
3R 32079331 3R 12366595..12366777 351..169 300 77.6 Minus
3R 32079331 3R 12377316..12377483 196..363 300 78.6 Plus
3R 32079331 3R 12367978..12368187 642..433 225 73.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12114933..12115664 1..732 3660 100 Plus
3R 31820162 3R 12112859..12113140 82..363 675 82.6 Plus
3R 31820162 3R 12116712..12116906 169..363 510 84.1 Plus
3R 31820162 3R 12109088..12109288 363..163 480 82.5 Minus
3R 31820162 3R 12117012..12117191 469..648 405 81.6 Plus
3R 31820162 3R 12113217..12113424 440..647 380 78.8 Plus
3R 31820162 3R 12119503..12119618 169..284 370 87.9 Plus
3R 31820162 3R 12114016..12114216 155..355 345 78.1 Plus
3R 31820162 3R 12114330..12114503 469..642 330 79.3 Plus
3R 31820162 3R 12106062..12106258 363..167 310 77.1 Minus
3R 31820162 3R 12118147..12118314 196..363 300 78.5 Plus
3R 31820162 3R 12120972..12121069 157..254 235 82.6 Plus
3R 31820162 3R 12107532..12107608 245..169 205 84.4 Minus
3R 31820162 3R 12119637..12119700 300..363 170 84.3 Plus
3R 31820162 3R 12105783..12105849 642..576 170 83.5 Minus
3R 31820162 3R 12116595..12116687 52..144 165 78.4 Plus
3R 31820162 3R 12121352..12121457 537..642 155 76.4 Plus
3R 31820162 3R 12107426..12107515 351..262 150 77.7 Minus
3R 31820162 3R 12121081..12121178 266..363 145 76.5 Plus
3R 31820162 3R 12108809..12108914 642..537 140 75.4 Minus
Blast to na_te.dros performed on 2019-03-16 12:54:16 has no hits.

RE70889.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:55:09 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8199488..8200210 1..723 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:35:12 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 1..648 52..699 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:08 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 1..648 52..699 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:01:33 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 1..648 52..699 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:49 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 1..648 52..699 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:07:11 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 1..648 52..699 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:59 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 1..723 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:08 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 1..723 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:01:33 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 1..723 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:50 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 1..723 1..723 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:07:11 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
GstD4-RA 3..725 1..723 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:09 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12374102..12374824 1..723 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:09 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12374102..12374824 1..723 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:09 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12374102..12374824 1..723 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:01:33 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8199824..8200546 1..723 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:09 Download gff for RE70889.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12114933..12115655 1..723 100   Plus

RE70889.hyp Sequence

Translation from 0 to 698

> RE70889.hyp
SFALPLQRIGNRNRPSNMDFYYSPRSSGSRTIIMVAKALGLELNKKQLRI
TEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDDSLF
PNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAA
FEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWY
ANAKKITPGWDENWKGLLQMKTMYEAQKASLK*

RE70889.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
GstD4-PA 215 CG11512-PA 1..215 18..232 1123 100 Plus
GstD2-PA 215 CG4181-PA 1..215 18..232 877 75.3 Plus
GstD5-PA 216 CG12242-PA 1..215 18..232 877 72.6 Plus
GstD1-PB 209 CG10045-PB 2..209 18..225 779 68.8 Plus
GstD1-PA 209 CG10045-PA 2..209 18..225 779 68.8 Plus

RE70889.pep Sequence

Translation from 51 to 698

> RE70889.pep
MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQH
TIPTLVDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFD
MGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGS
QLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGWDENWKGL
LQMKTMYEAQKASLK*

RE70889.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17943-PA 218 GF17943-PA 1..216 1..215 829 70.4 Plus
Dana\GF17052-PA 209 GF17052-PA 2..209 1..208 786 68.3 Plus
Dana\GF17947-PA 214 GF17947-PA 1..211 1..211 740 63 Plus
Dana\GF17054-PA 210 GF17054-PA 1..209 1..208 736 64.6 Plus
Dana\GF17946-PA 220 GF17946-PA 4..218 1..214 719 60.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18783-PA 216 GG18783-PA 1..215 1..215 898 73 Plus
Dere\GG18761-PA 215 GG18761-PA 1..215 1..215 885 74.9 Plus
Dere\GstD1-PA 209 GG17135-PA 3..209 2..208 773 67.1 Plus
Dere\GG18806-PA 212 GG18806-PA 1..204 1..204 749 64.7 Plus
Dere\GG18795-PA 224 GG18795-PA 4..217 1..213 740 64.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13103-PA 209 GH13103-PA 3..209 2..208 788 68.6 Plus
Dgri\GH20186-PA 209 GH20186-PA 3..209 2..208 786 68.1 Plus
Dgri\GH17521-PA 216 GH17521-PA 1..204 1..204 772 68.1 Plus
Dgri\GH20559-PA 216 GH20559-PA 1..204 1..204 772 68.1 Plus
Dgri\GH20548-PA 213 GH20548-PA 1..211 1..211 760 64 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
GstD4-PA 215 CG11512-PA 1..215 1..215 1123 100 Plus
GstD2-PA 215 CG4181-PA 1..215 1..215 877 75.3 Plus
GstD5-PA 216 CG12242-PA 1..215 1..215 877 72.6 Plus
GstD1-PB 209 CG10045-PB 2..209 1..208 779 68.8 Plus
GstD1-PA 209 CG10045-PA 2..209 1..208 779 68.8 Plus
GstD8-PA 212 CG4421-PA 1..208 1..208 738 64.4 Plus
GstD7-PA 224 CG4371-PA 4..217 1..213 714 64.5 Plus
GstD3-PA 199 CG4381-PA 1..199 17..215 705 64.8 Plus
GstD10-PB 210 CG18548-PB 1..209 1..208 698 62.2 Plus
GstD10-PA 210 CG18548-PA 1..209 1..208 698 62.2 Plus
GstD6-PA 215 CG4423-PA 1..196 1..196 689 63.8 Plus
GstD9-PB 218 CG10091-PB 2..210 1..207 672 58.4 Plus
GstD9-PA 218 CG10091-PA 2..210 1..207 672 58.4 Plus
GstD11-PA 222 CG17639-PA 7..190 4..187 399 41.3 Plus
GstD11-PB 243 CG17639-PB 28..211 4..187 399 41.3 Plus
GstE7-PA 223 CG17531-PA 16..200 13..195 365 40.9 Plus
GstE6-PA 222 CG17530-PA 16..214 13..208 361 37.2 Plus
GstE12-PC 223 CG16936-PC 7..218 4..212 359 36.8 Plus
GstE12-PB 223 CG16936-PB 7..218 4..212 359 36.8 Plus
GstE12-PD 223 CG16936-PD 7..218 4..212 359 36.8 Plus
GstE12-PA 223 CG16936-PA 7..218 4..212 359 36.8 Plus
GstE3-PA 220 CG17524-PA 16..199 13..195 351 37.8 Plus
GstE2-PA 221 CG17523-PA 17..206 13..200 344 38.9 Plus
GstE1-PA 224 CG5164-PA 18..196 13..189 343 40.2 Plus
GstE8-PB 222 CG17533-PB 7..200 4..195 342 37.4 Plus
GstE8-PA 222 CG17533-PA 7..200 4..195 342 37.4 Plus
GstE11-PB 225 CG5224-PB 8..208 4..200 341 38.1 Plus
GstE11-PA 225 CG5224-PA 8..208 4..200 341 38.1 Plus
GstE5-PA 222 CG17527-PA 16..215 13..209 338 36 Plus
GstE10-PB 240 CG17522-PB 7..206 4..199 330 36 Plus
GstE10-PA 240 CG17522-PA 7..206 4..199 330 36 Plus
GstE4-PA 222 CG17525-PA 4..220 1..214 318 32.3 Plus
GstE9-PA 221 CG17534-PA 16..188 13..182 293 36.4 Plus
GstE13-PB 226 CG11784-PB 7..212 4..205 290 34 Plus
GstE13-PA 226 CG11784-PA 7..212 4..205 290 34 Plus
GstE14-PA 232 CG4688-PA 9..214 4..209 290 29.3 Plus
gfzf-PD 234 CG33546-PD 1..189 1..187 277 34 Plus
gfzf-PE 1045 CG33546-PE 812..1000 1..187 277 34 Plus
gfzf-PB 1045 CG33546-PB 812..1000 1..187 277 34 Plus
GstT3-PC 228 CG1702-PC 7..203 3..188 172 25.4 Plus
GstT3-PA 228 CG1702-PA 7..203 3..188 172 25.4 Plus
GstT1-PA 228 CG30000-PA 7..226 3..212 161 25.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24379-PA 209 GI24379-PA 2..209 1..208 795 69.2 Plus
Dmoj\GI22354-PA 208 GI22354-PA 1..208 1..208 791 69.2 Plus
Dmoj\GI23194-PA 213 GI23194-PA 1..204 1..204 729 65.7 Plus
Dmoj\GI23195-PA 216 GI23195-PA 1..215 1..215 718 58.6 Plus
Dmoj\GI23193-PA 214 GI23193-PA 1..201 1..204 704 63.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27300-PA 217 GL27300-PA 1..215 1..215 873 72.6 Plus
Dper\GL27302-PA 215 GL27302-PA 1..215 1..215 780 64.7 Plus
Dper\GL27184-PA 209 GL27184-PA 3..209 2..208 774 66.7 Plus
Dper\GL27301-PA 213 GL27301-PA 1..213 1..212 759 62.9 Plus
Dper\GL27303-PA 213 GL27303-PA 1..212 1..211 733 63.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18009-PA 219 GA18009-PA 1..215 1..215 865 71.6 Plus
Dpse\GA27028-PA 215 GA27028-PA 1..215 1..215 779 64.7 Plus
Dpse\GA10031-PA 209 GA10031-PA 3..209 2..208 774 66.7 Plus
Dpse\GA27027-PA 213 GA27027-PA 1..213 1..212 756 62.4 Plus
Dpse\GA18171-PA 213 GA18171-PA 1..212 1..211 731 63.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24018-PA 215 GM24018-PA 1..215 1..215 1128 98.1 Plus
Dsec\GstD1-PA 209 GM26019-PA 3..209 2..208 783 68.1 Plus
Dsec\GM24021-PA 212 GM24021-PA 1..208 1..208 766 65.4 Plus
Dsec\GM24017-PA 215 GM24017-PA 1..215 1..215 751 62.8 Plus
Dsec\GM24020-PA 218 GM24020-PA 4..216 1..212 724 64.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18817-PA 215 GD18817-PA 1..215 1..215 1143 99.1 Plus
Dsim\GD18818-PA 216 GD18818-PA 1..215 1..215 895 73.5 Plus
Dsim\GD18815-PA 215 GD18815-PA 1..215 1..215 881 74.4 Plus
Dsim\GstD1-PA 209 GD20577-PA 3..209 2..208 782 68.1 Plus
Dsim\GD18821-PA 212 GD18821-PA 1..208 1..208 762 64.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24385-PA 209 GJ24385-PA 3..209 2..208 772 67.6 Plus
Dvir\GJ22855-PA 200 GJ22855-PA 1..199 17..215 750 67.8 Plus
Dvir\GJ22854-PA 213 GJ22854-PA 1..204 1..204 742 65.7 Plus
Dvir\GJ14446-PA 213 GJ14446-PA 1..212 1..212 737 60.8 Plus
Dvir\GJ22856-PA 200 GJ22856-PA 1..199 17..215 724 65.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11874-PA 219 GK11874-PA 1..213 1..213 837 70 Plus
Dwil\GK11202-PA 218 GK11202-PA 4..212 1..209 786 68.4 Plus
Dwil\GK11204-PA 209 GK11204-PA 3..209 2..208 781 67.1 Plus
Dwil\GK11875-PA 214 GK11875-PA 1..213 1..213 767 65.3 Plus
Dwil\GK11871-PA 215 GK11871-PA 1..215 1..215 765 63 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26177-PA 215 GE26177-PA 1..215 1..215 1075 91.6 Plus
Dyak\GE26178-PA 216 GE26178-PA 1..215 1..215 902 74 Plus
Dyak\GE26175-PA 215 GE26175-PA 1..215 1..215 893 74.9 Plus
Dyak\GE26173-PA 215 GE26173-PA 1..215 1..215 862 73 Plus
Dyak\GstD1-PA 209 GE24527-PA 3..209 2..208 790 69.1 Plus