Clone RE71331 Report

Search the DGRC for RE71331

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:713
Well:31
Vector:pFlc-1
Associated Gene/TranscriptCG17734-RA
Protein status:RE71331.pep: gold
Sequenced Size:745

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17734 2001-12-13 Blastp of sequenced clone
CG17734 2002-01-01 Sim4 clustering to Release 2
CG17734 2003-01-01 Sim4 clustering to Release 3
CG17734 2008-04-29 Release 5.5 accounting
CG17734 2008-08-15 Release 5.9 accounting
CG17734 2008-12-18 5.12 accounting

Clone Sequence Records

RE71331.complete Sequence

745 bp (745 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070609

> RE71331.complete
GTCCATTGCAGAAAGTTTCGCGAACGTTGCCAAGCGATTAAACCGATCCG
AACCGCCCGCGTACATAATATAATATTCGTGAAAATGAGTTCCAAGTCCC
TTTTCGACAGCGAGGAGGATGCCGCTCAGGCCAACAAATTATCCAGGAAA
GCAAAGGAATCGCCCTTCATGCTTGTGGGTATTACCGGATTCGTGGCCGC
CGGATTGATTGGAGCGTACAAGTACCGGAACCGCGGAACGATGAGCACCA
GCGTCTTCCTGATGCAGCTGCGAGTCGCCGCCCAGGGAACCGTCGTCGGA
TGTCTGACCCTCGGACTGGCCTACAGCATGGCCAAGGAGTACCTGTTCGA
CAAGGCGCCCAAGGAAAACACAAAGTCATTGACTAACTAAAGACCATCTG
ATTGCTCGGCGTCCCTCTCTAAAAATCACAAGATGACATCGGCTAGATCA
CTTACACATAAGCAATCAGACCCTCTATTTATTGCATCATCATGGTTCAT
ACCGATCCACTTGGATAGAATCACTGGAGGGCAGGACTCTCGCAAGTATT
CCCGAGCGTTCAAGCCCACAACATTAGATACAGTTTTGTAAACCTGCGTA
AGATTGTGATATTGTGTGTTTTAATGTACAAGTTGAACATCCAAACGAAA
GCTGTCGAAGCAGACGACAAGATGATAAATACCTCTCGCATGATATGATA
TACTTAAATAAATCAATTTAGACTAAAAGAAAAAAAAAAAAAAAA

RE71331.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-RA 992 CG17734-RA 217..948 1..732 3660 100 Plus
CG17734-RB 1185 CG17734-RB 150..517 1..368 1840 100 Plus
CG17734-RB 1185 CG17734-RB 778..1141 369..732 1820 100 Plus
CG11825.a 663 CG11825.a 111..384 82..355 710 83.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7067777..7068137 729..369 1805 100 Minus
chr3R 27901430 chr3R 7068401..7068588 365..178 940 100 Minus
chr3R 27901430 chr3R 7069354..7069533 180..1 855 98.3 Minus
chr2R 21145070 chr2R 6308193..6308466 355..82 710 83.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:14:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11242200..11242563 732..369 1820 100 Minus
3R 32079331 3R 11242824..11243014 368..178 955 100 Minus
3R 32079331 3R 11243780..11243959 180..1 900 100 Minus
2R 25286936 2R 10420733..10421006 355..82 710 83.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10983031..10983394 732..369 1820 100 Minus
3R 31820162 3R 10983655..10983845 368..178 955 100 Minus
3R 31820162 3R 10984611..10984790 180..1 900 100 Minus
2R 25260384 2R 10421932..10422205 355..82 710 83.9 Minus
Blast to na_te.dros performed on 2019-03-15 16:39:52 has no hits.

RE71331.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:40:58 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7067777..7068137 369..729 100 <- Minus
chr3R 7068398..7068587 179..368 99 <- Minus
chr3R 7069356..7069533 1..178 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:35:28 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 1..306 85..390 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:34 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 1..306 85..390 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:06:55 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 1..306 85..390 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:40 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 1..306 85..390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:45:10 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 1..306 85..390 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:47:23 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 18..746 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:34 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 20..743 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:06:55 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 41..764 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:40 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 18..746 1..729 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:45:10 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 41..764 1..724 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:40:58 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11242203..11242563 369..729 100 <- Minus
3R 11242824..11243013 179..368 100 <- Minus
3R 11243782..11243959 1..178 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:40:58 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11242203..11242563 369..729 100 <- Minus
3R 11242824..11243013 179..368 100 <- Minus
3R 11243782..11243959 1..178 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:40:58 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11242203..11242563 369..729 100 <- Minus
3R 11242824..11243013 179..368 100 <- Minus
3R 11243782..11243959 1..178 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:06:55 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7067925..7068285 369..729 100 <- Minus
arm_3R 7068546..7068735 179..368 100 <- Minus
arm_3R 7069504..7069681 1..178 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:38 Download gff for RE71331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10983034..10983394 369..729 100 <- Minus
3R 10983655..10983844 179..368 100 <- Minus
3R 10984613..10984790 1..178 100   Minus

RE71331.hyp Sequence

Translation from 0 to 389

> RE71331.hyp
VHCRKFRERCQAIKPIRTARVHNIIFVKMSSKSLFDSEEDAAQANKLSRK
AKESPFMLVGITGFVAAGLIGAYKYRNRGTMSTSVFLMQLRVAAQGTVVG
CLTLGLAYSMAKEYLFDKAPKENTKSLTN*

RE71331.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-PA 101 CG17734-PA 1..101 29..129 500 100 Plus
CG17734-PB 95 CG17734-PB 1..94 29..122 465 100 Plus
CG11825-PC 136 CG11825-PC 17..133 8..125 421 73.7 Plus
CG11825-PA 100 CG11825-PA 1..97 29..125 411 83.5 Plus
CG11825-PD 72 CG11825-PD 1..69 57..125 299 85.5 Plus

RE71331.pep Sequence

Translation from 84 to 389

> RE71331.pep
MSSKSLFDSEEDAAQANKLSRKAKESPFMLVGITGFVAAGLIGAYKYRNR
GTMSTSVFLMQLRVAAQGTVVGCLTLGLAYSMAKEYLFDKAPKENTKSLT
N*

RE71331.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18164-PA 101 GF18164-PA 1..101 1..101 477 89.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17229-PA 101 GG17229-PA 1..101 1..101 517 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18805-PA 101 GH18805-PA 1..101 1..101 474 90.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-PA 101 CG17734-PA 1..101 1..101 500 100 Plus
CG17734-PB 95 CG17734-PB 1..94 1..94 465 100 Plus
CG11825-PA 100 CG11825-PA 1..97 1..97 411 83.5 Plus
CG11825-PC 136 CG11825-PC 37..133 1..97 411 83.5 Plus
CG11825-PD 72 CG11825-PD 1..69 29..97 299 85.5 Plus
CG17734-PC 106 CG17734-PC 1..32 1..32 154 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10064-PA 95 GI10064-PA 1..94 1..94 429 85.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12612-PA 100 GL12612-PA 1..100 1..101 445 85.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14631-PA 100 GA14631-PA 1..100 1..101 445 85.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26107-PA 101 GM26107-PA 1..101 1..101 510 97 Plus
Dsec\GM20525-PA 100 GM20525-PA 1..97 1..97 441 84.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20668-PA 101 GD20668-PA 1..101 1..101 515 98 Plus
Dsim\GD10739-PA 100 GD10739-PA 1..97 1..97 432 83.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23799-PA 101 GJ23799-PA 1..101 1..101 467 86.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13290-PA 102 GK13290-PA 3..102 2..101 463 86 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24630-PA 101 GE24630-PA 1..101 1..101 513 98 Plus