Clone RE71337 Report

Search the DGRC for RE71337

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:713
Well:37
Vector:pFlc-1
Associated Gene/TranscriptCG13216-RA
Protein status:RE71337.pep: gold
Preliminary Size:777
Sequenced Size:901

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13216 2001-12-13 Blastp of sequenced clone
CG13216 2002-01-01 Sim4 clustering to Release 2
CG13216 2003-01-01 Sim4 clustering to Release 3
CG13216 2008-04-29 Release 5.5 accounting
CG13216 2008-08-15 Release 5.9 accounting
CG13216 2008-12-18 5.12 accounting

Clone Sequence Records

RE71337.complete Sequence

901 bp (901 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070610

> RE71337.complete
AGACGGTTGCCTCTAGAGATAGCTACCGAAATGACCAAGTTCGTTGCGAA
GAAAGCTATCCTGCTGCTCTCCCTGCTCCTTCTGGGCACGGCGGAGTCAA
AGCCACTGGATGCGGAACAGCAGCATATCGATGATCAGCATGTGCGAAAG
GAGCGTCAGCTGAAGATGGCCGGTTCTGCGGATCCAGACGTTAAAATGGT
GGCCAACGTGACTCCAGCGACGGGATCTCAACCAATGTCGATGACCATGG
GTGTGCCAATGAACCAGATGGCCCTGAGCTCGGTCGGTGGCCAGTTGGTG
CGGTATCCCAACTACCCGGGTCTGATCTATCCTGGCCTTGCGCCGGCACC
TGGCCTAAATGGTGTTCCCGGTCTGCAGACGAACATTGCCAACAACTATC
CCTCGTATCCGGATCCCAATCTGACTGGTTCAGTTCCTGGCTTCAATCCC
TTTGGCTCATTCGGCTACCCAGGCGTGGCACCCATGTATGGAAACTCCCT
GATGTATCCCAACCCCCAGCTGCCTAATGGATTTGTGCCCAATCCAGCCG
TAGATAACTTTCAATCGCTGAACAATATTGTCAATATGGCCAATGTTCAG
GGATTGGCTGGCGGCAGTTCCGGAATATATCCAGCACCTCAAGGATTCGG
TGGCGTTAGCCCGGGTCTATATCCCGCTCCGCAGGGATTCGGTGGAGCCA
ATCCAGGATTGTATCCAGCACCTCAGGTCAACATGCAGGGATTGTATCCA
CCATCCGGCGGTTTCCTGGAGCGCATGAACATGCAGGGCTATGCCCCAGG
CTTTTAATTGAGCCTTAAAAATCCATATATAATAAGCTAATTTATTTTAT
TTATTTTCGATAAATACAAGAACATTTATACAACAGAAAAAAAAAAAAAA
A

RE71337.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13216-RA 887 CG13216-RA 7..887 6..886 4390 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7125574..7126454 886..6 4375 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:14:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11238107..11238988 887..6 4395 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11239306..11240187 887..6 4395 99.8 Minus
Blast to na_te.dros performed 2019-03-16 06:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 2..55 856..803 108 66.7 Minus

RE71337.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:42:31 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7125574..7126458 1..886 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:35:30 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 1..777 31..807 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:07:05 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 1..777 31..807 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:40:59 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 1..777 31..807 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:41 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 1..777 31..807 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:19:39 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 1..777 31..807 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:47:25 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 2..887 1..886 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:07:05 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 2..887 1..886 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:40:59 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 3..888 1..886 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:41 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 2..887 1..886 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:19:39 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
CG13216-RA 3..888 1..886 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:42:31 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11238108..11238992 1..886 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:42:31 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11238108..11238992 1..886 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:42:31 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11238108..11238992 1..886 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:40:59 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7125613..7126497 1..886 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:08:06 Download gff for RE71337.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11239307..11240191 1..886 99   Minus

RE71337.hyp Sequence

Translation from 3 to 806

> RE71337.hyp
QLPLEIATEMTKFVAKKAILLLSLLLLGTAESKPLDAEQQHIDDQHVRKE
RQLKMAGSADPDVKMVANVTPATGSQPMSMTMGVPMNQMALSSVGGQLVR
YPNYPGLIYPGLAPAPGLNGVPGLQTNIANNYPSYPDPNLTGSVPGFNPF
GSFGYPGVAPMYGNSLMYPNPQLPNGFVPNPAVDNFQSLNNIVNMANVQG
LAGGSSGIYPAPQGFGGVSPGLYPAPQGFGGANPGLYPAPQVNMQGLYPP
SGGFLERMNMQGYAPGF*

RE71337.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13216-PA 258 CG13216-PA 1..258 10..267 1379 100 Plus

RE71337.pep Sequence

Translation from 30 to 806

> RE71337.pep
MTKFVAKKAILLLSLLLLGTAESKPLDAEQQHIDDQHVRKERQLKMAGSA
DPDVKMVANVTPATGSQPMSMTMGVPMNQMALSSVGGQLVRYPNYPGLIY
PGLAPAPGLNGVPGLQTNIANNYPSYPDPNLTGSVPGFNPFGSFGYPGVA
PMYGNSLMYPNPQLPNGFVPNPAVDNFQSLNNIVNMANVQGLAGGSSGIY
PAPQGFGGVSPGLYPAPQGFGGANPGLYPAPQVNMQGLYPPSGGFLERMN
MQGYAPGF*

RE71337.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12431-PA 232 GF12431-PA 1..232 1..258 612 60.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22690-PA 254 GG22690-PA 1..254 1..258 1112 89.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21949-PA 246 GH21949-PA 26..221 31..205 214 41 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13216-PA 258 CG13216-PA 1..258 1..258 1379 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19657-PA 248 GI19657-PA 1..108 1..124 154 43.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16757-PA 273 GL16757-PA 1..273 1..258 555 48.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12129-PA 273 GA12129-PA 1..273 1..258 553 48.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20467-PA 234 GM20467-PA 1..216 1..216 995 95.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25936-PA 258 GD25936-PA 1..258 1..258 1253 96.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15021-PA 242 GJ15021-PA 22..242 21..258 232 36.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20653-PA 228 GK20653-PA 2..215 1..217 286 41.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13045-PA 260 GE13045-PA 1..260 1..258 1145 91.9 Plus