Clone RE71379 Report

Search the DGRC for RE71379

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:713
Well:79
Vector:pFlc-1
Associated Gene/TranscriptCpr47Eb-RA
Protein status:RE71379.pep: gold
Preliminary Size:704
Sequenced Size:831

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13224 2001-12-13 Blastp of sequenced clone
CG13224 2002-01-01 Sim4 clustering to Release 2
CG13224 2003-01-01 Sim4 clustering to Release 3
Cpr47Eb 2008-04-29 Release 5.5 accounting
Cpr47Eb 2008-08-15 Release 5.9 accounting
Cpr47Eb 2008-12-18 5.12 accounting

Clone Sequence Records

RE71379.complete Sequence

831 bp (831 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070611

> RE71379.complete
AAGTCGTCCGTCGGTTCCCGCCTAGAAAGCACCAAATCTCTCCCATCTCT
CTCACCCCACAAGAATAGCCAACGAAATGTTCAAGATCGCCATCTGCTTG
TTGGCCCTGGTCGGCGGATCTCTGGCTGCCAGCATTGGCCAGGTTGACAG
CACCACCGAGAAGCGTGAGATTGTGCCTCTGCTGAGGTTTGAGACGAACA
AGAACCCCGATGGCTCCTTCCACTTCAGCTACGAGGGCGGTGACCAGTCC
GTGCGCCAGGAGCAGGGAGTGATCGAGAACGCCGGCACCGAGGACGAGGC
CTTGGAGGTGTCCGGTATGTACAGCTACATCGACGCCGATGGCAACACCG
TGGAGGTGCACTACACCGCCGGAAAGAACGGATTCGTGCCCATTGGCACC
ATCATTCCCAAGGAGATCACCGAGTTGGCCAAGTCAGCTGCCCTTCTGCC
CAAGGTTTCCGAGGATGAGCAGAAGTATCGCAAGGCCCGCTCCCAGGAAC
TGGACAATAAGGAAGTTGCTGTAGAGAAGGAAGCCGCCCCAGTGGAGAAG
GAGGAGCCTGTGGTTGCCAAGGAATCGGTTGTGGTGGAGAAATCCGAGCC
CCTGCCCGCCGAGTCCCAGGTGGCGCCTGTCCAGGTGGTCCTCGATGCCG
CGCCCCAAGCCGAGGTCAAGACCGCCATCGAGGCCGAGACCGAGAAGAAG
GTTGAGACCAAGACTGCCTAAGCTCTCCTAGAACCTAGACTACTCAAGTA
TTGTTTAATTTAAAATCAAGTGCGATCTAATTTAACTGGCTAGCAATAAA
ACGATTCCCTATCTGAAAAAAAAAAAAAAAA

RE71379.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr47Eb-RA 815 Cpr47Eb-RA 1..815 1..815 4075 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7142633..7143447 1..815 4030 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:14:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11255169..11255986 1..818 4090 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11256368..11257185 1..818 4090 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:39:55 has no hits.

RE71379.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:40:59 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7142633..7143447 1..815 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:35:32 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 1..645 77..721 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:49 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 1..645 77..721 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:06:59 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 1..645 77..721 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:43 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 1..645 77..721 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:45:13 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 1..645 77..721 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:47:28 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 1..815 1..815 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:49 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 1..815 1..815 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:06:59 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 3..817 1..815 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:43 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 1..815 1..815 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:45:13 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr47Eb-RA 3..817 1..815 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:40:59 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11255169..11255983 1..815 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:40:59 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11255169..11255983 1..815 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:40:59 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11255169..11255983 1..815 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:06:59 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7142674..7143488 1..815 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:48 Download gff for RE71379.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11256368..11257182 1..815 100   Plus

RE71379.pep Sequence

Translation from 76 to 720

> RE71379.pep
MFKIAICLLALVGGSLAASIGQVDSTTEKREIVPLLRFETNKNPDGSFHF
SYEGGDQSVRQEQGVIENAGTEDEALEVSGMYSYIDADGNTVEVHYTAGK
NGFVPIGTIIPKEITELAKSAALLPKVSEDEQKYRKARSQELDNKEVAVE
KEAAPVEKEEPVVAKESVVVEKSEPLPAESQVAPVQVVLDAAPQAEVKTA
IEAETEKKVETKTA*

RE71379.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12537-PA 207 GF12537-PA 1..191 1..198 658 72.7 Plus
Dana\GF12426-PA 130 GF12426-PA 26..125 30..129 275 55 Plus
Dana\GF24646-PA 137 GF24646-PA 1..133 1..136 225 41.1 Plus
Dana\GF12424-PA 613 GF12424-PA 118..196 33..111 185 44.3 Plus
Dana\GF10920-PA 111 GF10920-PA 6..111 6..113 182 37 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20182-PA 218 GG20182-PA 1..218 1..214 989 87.6 Plus
Dere\GG22685-PA 129 GG22685-PA 1..122 6..126 244 44.3 Plus
Dere\GG13213-PA 137 GG13213-PA 1..133 1..136 225 43.1 Plus
Dere\GG22683-PA 594 GG22683-PA 125..203 33..111 186 44.3 Plus
Dere\GG14081-PA 111 GG14081-PA 1..111 1..113 181 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19947-PA 265 GH19947-PA 1..182 1..187 520 55.6 Plus
Dgri\GH21942-PA 129 GH21942-PA 1..123 1..126 270 49.2 Plus
Dgri\GH15102-PA 131 GH15102-PA 1..129 1..129 222 41.5 Plus
Dgri\GH21941-PA 143 GH21941-PA 1..142 1..132 218 36.5 Plus
Dgri\GH15653-PA 114 GH15653-PA 1..114 1..113 177 37.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr47Eb-PA 214 CG13224-PA 1..214 1..214 1059 100 Plus
Cpr47Ec-PA 131 CG9077-PA 4..130 8..135 240 43.8 Plus
Cpr78E-PA 137 CG7160-PA 1..133 1..136 227 42.3 Plus
Cpr47Ef-PD 601 CG13214-PD 134..212 33..111 194 44.3 Plus
Cpr47Ef-PC 612 CG13214-PC 134..212 33..111 194 44.3 Plus
Cpr65Av-PA 111 CG32405-PA 9..109 4..111 181 37 Plus
Lcp65Ac-PA 109 CG6956-PA 5..103 4..111 173 38 Plus
Acp65Aa-PA 105 CG10297-PA 4..105 9..112 171 33.7 Plus
Cpr47Ed-PA 127 CG9076-PA 28..101 33..105 170 47.3 Plus
Lcp65Ad-PB 108 CG6955-PB 3..107 2..114 167 33.6 Plus
Lcp65Ad-PA 108 CG6955-PA 3..107 2..114 167 33.6 Plus
Cpr65Ax2-PB 102 CG18777-PB 2..97 3..111 163 37.6 Plus
Cpr65Ax2-PA 102 CG18777-PA 2..97 3..111 163 37.6 Plus
Cpr65Ax1-PA 102 CG34270-PA 2..97 3..111 163 37.6 Plus
Lcp65Af-PA 100 CG10533-PA 18..95 33..111 162 41.8 Plus
Lcp65Ag2-PA 105 CG10534-PA 2..100 3..111 158 35.8 Plus
Lcp65Ag1-PA 105 CG10530-PA 2..100 3..111 158 35.8 Plus
Lcp65Ag3-PA 105 CG18779-PA 2..100 3..111 158 35.8 Plus
Cpr65Az-PA 239 CG12330-PA 112..193 31..111 153 36.6 Plus
Cpr49Aa-PB 144 CG30045-PB 29..109 31..111 147 34.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19904-PA 384 GI19904-PA 1..191 1..192 476 53.7 Plus
Dmoj\GI19649-PA 184 GI19649-PA 63..184 19..140 278 47.5 Plus
Dmoj\GI13751-PA 145 GI13751-PA 24..121 22..119 232 51 Plus
Dmoj\GI12698-PA 111 GI12698-PA 9..111 4..113 176 37.8 Plus
Dmoj\GI19649-PA 184 GI19649-PA 3..48 76..121 164 67.4 Plus
Dmoj\GI12627-PA 112 GI12627-PA 2..107 3..111 163 33 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17720-PA 240 GL17720-PA 1..240 1..214 634 63.8 Plus
Dper\GL16751-PA 132 GL16751-PA 24..120 30..126 271 55.7 Plus
Dper\GL25283-PA 138 GL25283-PA 1..134 1..136 226 41.1 Plus
Dper\GL15515-PA 111 GL15515-PA 1..111 1..113 195 38.1 Plus
Dper\GL15520-PA 104 GL15520-PA 22..99 33..111 165 44.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12136-PA 240 GA12136-PA 1..240 1..214 634 63.8 Plus
Dpse\GA21523-PA 132 GA21523-PA 24..120 30..126 271 55.7 Plus
Dpse\GA20144-PA 138 GA20144-PA 1..134 1..136 226 41.1 Plus
Dpse\GA16877-PA 111 GA16877-PA 1..111 1..113 195 38.1 Plus
Dpse\GA23851-PA 104 GA23851-PA 22..99 33..111 165 44.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21270-PA 214 GM21270-PA 1..214 1..214 1060 96.3 Plus
Dsec\GM20463-PA 131 GM20463-PA 4..127 8..132 238 44.8 Plus
Dsec\GM22121-PA 137 GM22121-PA 1..118 1..119 228 46.7 Plus
Dsec\GM13864-PA 111 GM13864-PA 6..111 1..113 185 35.4 Plus
Dsec\GM20462-PA 127 GM20462-PA 1..101 1..105 176 41.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10782-PA 214 GD10782-PA 1..214 1..214 1060 96.3 Plus
Dsim\GD25932-PA 131 GD25932-PA 26..127 30..132 243 52.4 Plus
Dsim\GD12099-PA 137 GD12099-PA 1..118 1..119 231 46.7 Plus
Dsim\GD13147-PA 111 GD13147-PA 6..111 1..113 185 35.4 Plus
Dsim\GD25931-PA 117 GD25931-PA 1..101 1..105 176 41.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15073-PA 196 GJ15073-PA 1..155 1..158 508 61.3 Plus
Dvir\GJ15016-PA 129 GJ15016-PA 1..128 1..133 295 49.6 Plus
Dvir\GJ15015-PA 145 GJ15015-PA 1..133 1..121 262 40.6 Plus
Dvir\GJ14096-PA 140 GJ14096-PA 1..122 1..122 229 43.4 Plus
Dvir\GJ12738-PA 110 GJ12738-PA 31..109 35..114 173 41.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20958-PA 197 GK20958-PA 5..143 4..141 495 68.6 Plus
Dwil\GK20647-PA 131 GK20647-PA 1..123 1..126 297 49.2 Plus
Dwil\GK17131-PA 137 GK17131-PA 1..121 1..122 204 39.8 Plus
Dwil\GK16920-PA 111 GK16920-PA 6..111 1..113 197 37.2 Plus
Dwil\GK21628-PA 602 GK21628-PA 91..195 21..122 194 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12869-PA 216 GE12869-PA 1..216 1..214 1008 91.2 Plus
Dyak\GE13040-PA 129 GE13040-PA 26..122 30..126 248 52.6 Plus
Dyak\GE22707-PA 137 GE22707-PA 1..133 1..136 217 41.6 Plus
Dyak\GE22306-PA 137 GE22306-PA 1..133 1..136 217 41.6 Plus
Dyak\GE20507-PA 111 GE20507-PA 1..111 1..113 190 36.3 Plus

RE71379.hyp Sequence

Translation from 76 to 720

> RE71379.hyp
MFKIAICLLALVGGSLAASIGQVDSTTEKREIVPLLRFETNKNPDGSFHF
SYEGGDQSVRQEQGVIENAGTEDEALEVSGMYSYIDADGNTVEVHYTAGK
NGFVPIGTIIPKEITELAKSAALLPKVSEDEQKYRKARSQELDNKEVAVE
KEAAPVEKEEPVVAKESVVVEKSEPLPAESQVAPVQVVLDAAPQAEVKTA
IEAETEKKVETKTA*

RE71379.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr47Eb-PA 214 CG13224-PA 1..214 1..214 1059 100 Plus
Cpr47Ec-PA 131 CG9077-PA 4..130 8..135 240 43.8 Plus
Cpr78E-PA 137 CG7160-PA 1..133 1..136 227 42.3 Plus
Cpr47Ef-PD 601 CG13214-PD 134..212 33..111 194 44.3 Plus
Cpr47Ef-PC 612 CG13214-PC 134..212 33..111 194 44.3 Plus