BDGP Sequence Production Resources |
Search the DGRC for RE72116
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 721 |
Well: | 16 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL42-RA |
Protein status: | RE72116.pep: gold |
Preliminary Size: | 375 |
Sequenced Size: | 610 |
Gene | Date | Evidence |
---|---|---|
CG12921 | 2001-12-13 | Blastp of sequenced clone |
CG12921 | 2002-01-01 | Sim4 clustering to Release 2 |
CG12921 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL42 | 2008-04-29 | Release 5.5 accounting |
mRpL42 | 2008-08-15 | Release 5.9 accounting |
mRpL42 | 2008-12-18 | 5.12 accounting |
610 bp (610 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070620
> RE72116.complete AGCGTTTTTTGCCTAACCATTACAGAGTAAGCATACAAATGGTTTCAGTT TTCTTTTTGACGTATTAGCTATTTTTATCCAAGTAGCTAATGTTGCATCA CTGCCCATTAATTAGAACGATAACATTCCAGCTGTTCAGTTATCGGTTCA TCTCTAATTGTGAAAATGTCAGCGGCACGTTTATACGGAGGATTTCGTTT ATTTTCCTCGAGTGCCGTGCAGCGCAATGCCGTCGGTGGCAAGAGCCTGG TGGAGGCCGTGGCAGTGACCAAAAATGGTCGCACCATTGTGGCCTGGCAT CCGGACACACCAGTTCCCTACGAGAACACCCTGCCGCTGCCAGAGATCAG CGAGATTCAGAGCTCGGCGGTGGTTAAGGAATCGGCTCTGAAGACGGCGA TGCGTGCCTTTAAAAGCAAACATCCAGAAGTGGCTCGCCAGGAGCTGATG CAGCTGACCCACACGACTAAACACCGCTGGTTTCCACGCGCCCGCGACAG GAAGGCCAAGCAAACGCCGATGGACCGGCCGTACCTATAGTTTTCCACCC AGTGCATTGCATAATGTTCAAATAAATTCGTTCTCATTTACTCCAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 5954195..5954788 | 1..594 | 2955 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 10066649..10067243 | 1..595 | 2960 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 10067848..10068442 | 1..595 | 2960 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Max-element | 8556 | Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). | 1426..1517 | 1..89 | 111 | 59.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 5954195..5954788 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RA | 1..375 | 166..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RB | 1..375 | 166..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RA | 1..375 | 166..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RA | 1..375 | 166..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RA | 1..375 | 166..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RA | 1..594 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RA | 1..594 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RA | 1..593 | 2..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RA | 1..594 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL42-RA | 1..593 | 2..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10066649..10067242 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10066649..10067242 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10066649..10067242 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 5954154..5954747 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10067848..10068441 | 1..594 | 99 | Plus |
Translation from 165 to 539
> RE72116.pep MSAARLYGGFRLFSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDTPV PYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVARQELMQLTHT TKHRWFPRARDRKAKQTPMDRPYL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12014-PA | 124 | GF12014-PA | 1..124 | 1..124 | 572 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24134-PA | 124 | GG24134-PA | 1..124 | 1..124 | 645 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16997-PA | 127 | GH16997-PA | 2..127 | 3..124 | 476 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL42-PB | 124 | CG12921-PB | 1..124 | 1..124 | 637 | 100 | Plus |
mRpL42-PA | 124 | CG12921-PA | 1..124 | 1..124 | 637 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11410-PA | 128 | GI11410-PA | 1..128 | 1..124 | 489 | 73.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11516-PA | 125 | GL11516-PA | 4..125 | 3..124 | 500 | 73.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11910-PA | 125 | GA11910-PA | 4..125 | 3..124 | 500 | 73.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21179-PA | 124 | GM21179-PA | 1..124 | 1..124 | 649 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10711-PA | 124 | GD10711-PA | 1..124 | 1..124 | 649 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13606-PA | 128 | GJ13606-PA | 1..128 | 1..124 | 511 | 74.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21960-PA | 126 | GK21960-PA | 1..126 | 1..124 | 489 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19333-PA | 124 | GE19333-PA | 1..124 | 1..124 | 624 | 95.2 | Plus |
Translation from 165 to 539
> RE72116.hyp MSAARLYGGFRLFSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDTPV PYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVARQELMQLTHT TKHRWFPRARDRKAKQTPMDRPYL*