Clone RE72116 Report

Search the DGRC for RE72116

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:721
Well:16
Vector:pFlc-1
Associated Gene/TranscriptmRpL42-RA
Protein status:RE72116.pep: gold
Preliminary Size:375
Sequenced Size:610

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12921 2001-12-13 Blastp of sequenced clone
CG12921 2002-01-01 Sim4 clustering to Release 2
CG12921 2003-01-01 Sim4 clustering to Release 3
mRpL42 2008-04-29 Release 5.5 accounting
mRpL42 2008-08-15 Release 5.9 accounting
mRpL42 2008-12-18 5.12 accounting

Clone Sequence Records

RE72116.complete Sequence

610 bp (610 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070620

> RE72116.complete
AGCGTTTTTTGCCTAACCATTACAGAGTAAGCATACAAATGGTTTCAGTT
TTCTTTTTGACGTATTAGCTATTTTTATCCAAGTAGCTAATGTTGCATCA
CTGCCCATTAATTAGAACGATAACATTCCAGCTGTTCAGTTATCGGTTCA
TCTCTAATTGTGAAAATGTCAGCGGCACGTTTATACGGAGGATTTCGTTT
ATTTTCCTCGAGTGCCGTGCAGCGCAATGCCGTCGGTGGCAAGAGCCTGG
TGGAGGCCGTGGCAGTGACCAAAAATGGTCGCACCATTGTGGCCTGGCAT
CCGGACACACCAGTTCCCTACGAGAACACCCTGCCGCTGCCAGAGATCAG
CGAGATTCAGAGCTCGGCGGTGGTTAAGGAATCGGCTCTGAAGACGGCGA
TGCGTGCCTTTAAAAGCAAACATCCAGAAGTGGCTCGCCAGGAGCTGATG
CAGCTGACCCACACGACTAAACACCGCTGGTTTCCACGCGCCCGCGACAG
GAAGGCCAAGCAAACGCCGATGGACCGGCCGTACCTATAGTTTTCCACCC
AGTGCATTGCATAATGTTCAAATAAATTCGTTCTCATTTACTCCAAAAAA
AAAAAAAAAA

RE72116.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL42-RA 595 mRpL42-RA 1..595 1..595 2960 99.8 Plus
mRpL42.a 538 mRpL42.a 27..538 84..595 2560 100 Plus
mRpL42.b 493 mRpL42.b 30..493 132..595 2320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5954195..5954788 1..594 2955 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:15:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10066649..10067243 1..595 2960 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10067848..10068442 1..595 2960 99.8 Plus
Blast to na_te.dros performed 2019-03-16 21:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1426..1517 1..89 111 59.8 Plus

RE72116.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:27:02 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5954195..5954788 1..594 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:35:52 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RA 1..375 166..540 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:56 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RB 1..375 166..540 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:38:45 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RA 1..375 166..540 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:07 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RA 1..375 166..540 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:18:53 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RA 1..375 166..540 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:04 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RA 1..594 1..594 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:56 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RA 1..594 1..594 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:45 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RA 1..593 2..594 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:07 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RA 1..594 1..594 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:18:53 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL42-RA 1..593 2..594 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:02 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10066649..10067242 1..594 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:02 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10066649..10067242 1..594 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:02 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10066649..10067242 1..594 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:45 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5954154..5954747 1..594 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:54 Download gff for RE72116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10067848..10068441 1..594 99   Plus

RE72116.pep Sequence

Translation from 165 to 539

> RE72116.pep
MSAARLYGGFRLFSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDTPV
PYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVARQELMQLTHT
TKHRWFPRARDRKAKQTPMDRPYL*

RE72116.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12014-PA 124 GF12014-PA 1..124 1..124 572 84.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24134-PA 124 GG24134-PA 1..124 1..124 645 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16997-PA 127 GH16997-PA 2..127 3..124 476 69 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL42-PB 124 CG12921-PB 1..124 1..124 637 100 Plus
mRpL42-PA 124 CG12921-PA 1..124 1..124 637 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11410-PA 128 GI11410-PA 1..128 1..124 489 73.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11516-PA 125 GL11516-PA 4..125 3..124 500 73.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11910-PA 125 GA11910-PA 4..125 3..124 500 73.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21179-PA 124 GM21179-PA 1..124 1..124 649 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10711-PA 124 GD10711-PA 1..124 1..124 649 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13606-PA 128 GJ13606-PA 1..128 1..124 511 74.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21960-PA 126 GK21960-PA 1..126 1..124 489 72.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19333-PA 124 GE19333-PA 1..124 1..124 624 95.2 Plus

RE72116.hyp Sequence

Translation from 165 to 539

> RE72116.hyp
MSAARLYGGFRLFSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDTPV
PYENTLPLPEISEIQSSAVVKESALKTAMRAFKSKHPEVARQELMQLTHT
TKHRWFPRARDRKAKQTPMDRPYL*

RE72116.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL42-PB 124 CG12921-PB 1..124 1..124 637 100 Plus
mRpL42-PA 124 CG12921-PA 1..124 1..124 637 100 Plus