Clone RE72254 Report

Search the DGRC for RE72254

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:722
Well:54
Vector:pFlc-1
Associated Gene/TranscriptiotaTry-RA
Protein status:RE72254.pep: gold
Preliminary Size:759
Sequenced Size:843

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7754 2002-01-01 Sim4 clustering to Release 2
CG7754 2002-04-21 Blastp of sequenced clone
CG7754 2003-01-01 Sim4 clustering to Release 3
iotaTry 2008-04-29 Release 5.5 accounting
iotaTry 2008-08-15 Release 5.9 accounting
iotaTry 2008-12-18 5.12 accounting

Clone Sequence Records

RE72254.complete Sequence

843 bp (843 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113550

> RE72254.complete
AGTTTGCACTTGGCTTTCGGAATGGCTGTTTACGGAATAGTGGCTACGGT
GCTGGTCCTTTTGCTGCTCGGCGATGCGTCAGATGTCGAGGCCACTGGAC
GAATTATTGGCGGAAGCGATCAGCTGATTCGTAACGCCCCCTGGCAGGTG
TCTATTCAGATCAGTGCGCGCCACGAGTGCGGCGGAGTCATCTATAGCAA
GGAGATCATCATCACAGCCGGACACTGTCTACATGAGAGATCCGTGACGC
TGATGAAGGTGCGTGTGGGTGCACAGAATCACAACTACGGCGGCACATTG
GTTCCTGTGGCGGCGTACAAAGTCCACGAGCAGTTTGATTCCCGCTTCCT
GCACTACGACATTGCCGTGCTTCGTCTGTCCACACCACTGACCTTTGGCC
TCTCAACGAGAGCCATCAATTTAGCCAGTACGAGTCCATCGGGTGGAACA
ACAGTCACTGTCACGGGTTGGGGCCACACTGATAATGGAGCCCTCTCCGA
TAGCTTGCAGAAGGCCCAGTTGCAGATCATCGATCGCGGAGAGTGTGCCT
CGCAAAAGTTTGGCTACGGTGCGGATTTTGTGGGCGAGGAAACAATTTGC
GCTGCCAGCACTGATGCAGATGCCTGTACGGGAGACTCTGGAGGTCCTTT
GGTGGCCAGTAGCCAGCTGGTGGGCATTGTATCCTGGGGTTACCGGTGTG
CGGACGACAACTACCCCGGTGTCTATGCCGATGTGGCGATTCTGCGACCT
TGGATAGTCAAGGCGGCCAATGCCATATGAACAGATTTTGGAAAATAAAG
ACCATGCTTAAAAAAGTTTAAAAAAAGAAAAAAAAAAAAAAAA

RE72254.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
iotaTry-RA 819 iotaTry-RA 1..819 1..819 4095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7244172..7244992 1..821 4090 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:15:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11356722..11357542 1..821 4105 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11357921..11358741 1..821 4105 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:29:35 has no hits.

RE72254.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:30:35 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7244172..7244997 1..827 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:35:58 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 1..759 22..780 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:36 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 1..759 22..780 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:14:06 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 1..759 22..780 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:56 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 1..759 22..780 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:22:41 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 1..759 22..780 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:22 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 1..815 1..815 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:36 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 1..815 1..815 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:06 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 3..818 1..816 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:56 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 1..815 1..815 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:22:41 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
iotaTry-RA 3..818 1..816 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:30:35 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11356722..11357547 1..827 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:30:35 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11356722..11357547 1..827 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:30:35 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11356722..11357547 1..827 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:06 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7244227..7245052 1..827 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:02 Download gff for RE72254.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11357921..11358746 1..827 99   Plus

RE72254.hyp Sequence

Translation from 0 to 779

> RE72254.hyp
SLHLAFGMAVYGIVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQV
SIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNHNYGGTL
VPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGT
TVTVTGWGHTDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETIC
AASTDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRP
WIVKAANAI*

RE72254.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
iotaTry-PA 252 CG7754-PA 1..252 8..259 1304 100 Plus
alphaTry-PA 256 CG18444-PA 29..256 33..259 583 48 Plus
Ser8-PA 260 CG4812-PA 4..260 13..259 569 45 Plus
gammaTry-PA 253 CG30028-PA 29..253 33..256 553 45.1 Plus
deltaTry-PA 253 CG12351-PA 29..253 33..256 553 45.1 Plus

RE72254.pep Sequence

Translation from 21 to 779

> RE72254.pep
MAVYGIVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISAR
HECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYK
VHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGW
GHTDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAASTDAD
ACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKAAN
AI*

RE72254.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12548-PA 257 GF12548-PA 30..257 26..252 978 78.5 Plus
Dana\GF12546-PA 256 GF12546-PA 29..256 26..252 551 48.9 Plus
Dana\GF13692-PA 261 GF13692-PA 33..261 26..252 550 47.8 Plus
Dana\GF12402-PA 256 GF12402-PA 1..256 1..252 531 42 Plus
Dana\GF12403-PA 256 GF12403-PA 29..256 26..252 530 48.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20196-PA 252 GG20196-PA 1..252 1..252 1160 93.3 Plus
Dere\GG20381-PA 259 GG20381-PA 32..259 26..252 554 46.7 Plus
Dere\epsilonTry-PA 256 GG22660-PA 1..256 1..252 517 41.6 Plus
Dere\alphaTry-PA 256 GG22661-PA 29..256 26..252 504 47.2 Plus
Dere\betaTry-PA 253 GG20194-PA 29..253 26..249 490 44.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22928-PA 243 GH22928-PA 10..243 26..252 804 62.4 Plus
Dgri\GH22926-PA 256 GH22926-PA 29..256 26..252 528 43.2 Plus
Dgri\GH22924-PA 256 GH22924-PA 29..256 26..252 513 42.4 Plus
Dgri\GH22925-PA 254 GH22925-PA 29..253 26..249 508 42.9 Plus
Dgri\GH22866-PA 255 GH22866-PA 29..255 26..252 507 43.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
iotaTry-PA 252 CG7754-PA 1..252 1..252 1304 100 Plus
alphaTry-PA 256 CG18444-PA 29..256 26..252 583 48 Plus
Ser8-PA 260 CG4812-PA 4..260 6..252 569 45 Plus
gammaTry-PA 253 CG30028-PA 29..253 26..249 553 45.1 Plus
CG30025-PA 253 CG30025-PA 29..253 26..249 553 45.1 Plus
deltaTry-PA 253 CG12351-PA 29..253 26..249 553 45.1 Plus
CG30031-PA 253 CG30031-PA 29..253 26..249 553 45.1 Plus
betaTry-PB 253 CG18211-PB 29..253 26..249 537 44.2 Plus
betaTry-PA 253 CG18211-PA 29..253 26..249 537 44.2 Plus
epsilonTry-PA 256 CG18681-PA 1..256 1..252 528 42 Plus
CG17571-PB 258 CG17571-PB 29..258 26..252 508 43 Plus
CG17571-PA 258 CG17571-PA 29..258 26..252 508 43 Plus
thetaTry-PA 262 CG12385-PA 30..262 23..252 465 41 Plus
CG17239-PB 248 CG17239-PB 23..244 27..252 464 43.6 Plus
CG17239-PA 248 CG17239-PA 23..244 27..252 464 43.6 Plus
Ser12-PA 245 CG17240-PA 1..241 1..248 452 42.8 Plus
Send1-PA 255 CG17012-PA 10..246 1..252 406 40.6 Plus
CG7829-PA 253 CG7829-PA 27..250 27..250 391 39.9 Plus
CG31954-PA 277 CG31954-PA 49..271 26..245 391 39.8 Plus
CG31681-PA 264 CG31681-PA 28..249 27..245 387 40.1 Plus
Send2-PA 239 CG18125-PA 3..232 7..252 378 39.8 Plus
etaTry-PA 262 CG12386-PA 5..256 6..247 374 37.6 Plus
Try29F-PD 267 CG9564-PD 40..261 26..245 363 35.1 Plus
Try29F-PC 267 CG9564-PC 40..261 26..245 363 35.1 Plus
CG13430-PB 267 CG13430-PB 22..261 18..247 358 36.8 Plus
CG13430-PA 267 CG13430-PA 22..261 18..247 358 36.8 Plus
CG17234-PA 251 CG17234-PA 26..250 27..252 353 38.4 Plus
lambdaTry-PA 272 CG12350-PA 34..258 26..247 352 36.7 Plus
CG11192-PB 279 CG11192-PB 10..265 10..251 349 32.4 Plus
Sb-PB 787 CG4316-PB 543..784 27..247 346 34.7 Plus
Sb-PA 787 CG4316-PA 543..784 27..247 346 34.7 Plus
CG10405-PB 268 CG10405-PB 12..262 6..245 345 35.8 Plus
zetaTry-PA 280 CG12387-PA 16..273 6..245 344 37.5 Plus
kappaTry-PC 263 CG12388-PC 5..253 11..245 341 36.9 Plus
CG34458-PA 257 CG34458-PA 14..256 10..250 335 32.8 Plus
CG17242-PA 245 CG17242-PA 6..232 13..245 333 36.2 Plus
CG17242-PB 245 CG17242-PB 6..232 13..245 333 36.2 Plus
CG5246-PA 272 CG5246-PA 36..261 22..245 332 37.4 Plus
CG3650-PA 249 CG3650-PA 10..246 11..248 325 33.6 Plus
CG8299-PA 260 CG8299-PA 13..258 11..251 321 32 Plus
Ser6-PA 259 CG2071-PA 14..255 10..247 320 33.7 Plus
CG32376-PA 291 CG32376-PA 65..286 27..247 320 35.3 Plus
CG32269-PB 332 CG32269-PB 100..324 19..244 320 31.9 Plus
CG32269-PA 332 CG32269-PA 100..324 19..244 320 31.9 Plus
CG32271-PA 248 CG32271-PA 7..245 10..248 319 34.7 Plus
CG32270-PA 259 CG32270-PA 24..251 21..245 317 35 Plus
CG31269-PB 273 CG31269-PB 1..255 7..245 316 34.5 Plus
CG31265-PA 266 CG31265-PA 34..254 25..245 315 36.2 Plus
CG11836-PI 281 CG11836-PI 44..270 27..245 315 32.9 Plus
CG11836-PJ 333 CG11836-PJ 96..322 27..245 315 32.9 Plus
CG9676-PA 251 CG9676-PA 7..250 9..250 310 33.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18415-PA 260 GI18415-PA 31..258 26..250 736 64.9 Plus
Dmoj\GI21243-PA 255 GI21243-PA 29..255 26..252 546 45.6 Plus
Dmoj\GI17437-PA 238 GI17437-PA 9..235 26..249 501 43.6 Plus
Dmoj\GI17438-PA 258 GI17438-PA 29..255 26..249 501 43.6 Plus
Dmoj\GI20607-PA 261 GI20607-PA 35..261 27..252 498 43.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17144-PA 252 GL17144-PA 22..252 23..252 947 75.3 Plus
Dper\GL17339-PA 256 GL17339-PA 29..256 26..252 565 48.5 Plus
Dper\GL17142-PA 256 GL17142-PA 29..256 26..252 547 48.9 Plus
Dper\GL17143-PA 256 GL17143-PA 29..256 26..252 532 47.2 Plus
Dper\GL17338-PA 256 GL17338-PA 29..256 26..252 528 46.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20562-PA 252 GA20562-PA 22..252 23..252 948 75.3 Plus
Dpse\GA14937-PA 256 GA14937-PA 29..256 26..252 565 48.5 Plus
Dpse\GA24979-PA 256 GA24979-PA 29..256 26..252 549 48.9 Plus
Dpse\GA15051-PA 256 GA15051-PA 29..256 26..252 538 46.7 Plus
Dpse\GA24980-PA 256 GA24980-PA 29..256 26..252 530 47.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21283-PA 266 GM21283-PA 29..266 26..252 1014 84.9 Plus
Dsec\GM21468-PA 260 GM21468-PA 34..260 27..252 565 48.2 Plus
Dsec\GM20441-PA 256 GM20441-PA 29..256 26..252 504 47.2 Plus
Dsec\GM18246-PA 248 GM18246-PA 23..244 27..252 458 43.2 Plus
Dsec\GM18144-PA 277 GM18144-PA 49..271 26..245 398 39.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15392-PA 290 GD15392-PA 1..248 1..248 1181 95.6 Plus
Dsim\GD15412-PA 260 GD15412-PA 34..260 27..252 564 48.2 Plus
Dsim\GD15391-PA 253 GD15391-PA 29..253 26..249 506 45.6 Plus
Dsim\GD21711-PA 258 GD21711-PA 29..258 26..252 501 42.2 Plus
Dsim\GD25907-PA 485 GD25907-PA 258..485 26..252 480 46.3 Plus
Dsim\GD25907-PA 485 GD25907-PA 1..232 1..228 461 40.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Try2-PA 259 GJ21501-PA 30..259 26..252 781 66.1 Plus
Dvir\GJ21048-PA 259 GJ21048-PA 5..259 9..252 535 46.5 Plus
Dvir\GJ21498-PA 256 GJ21498-PA 29..256 26..252 515 45.9 Plus
Dvir\Try1-PA 256 GJ21500-PA 29..256 26..252 514 48.5 Plus
Dvir\GJ21499-PA 256 GJ21499-PA 29..256 26..252 514 48.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19694-PA 265 GK19694-PA 29..265 27..252 821 67.1 Plus
Dwil\GK19007-PA 261 GK19007-PA 24..261 16..252 558 47.7 Plus
Dwil\GK21995-PA 256 GK21995-PA 29..256 26..252 548 48 Plus
Dwil\GK21994-PA 256 GK21994-PA 29..256 26..252 548 46.7 Plus
Dwil\GK19676-PA 244 GK19676-PA 4..244 15..252 540 46.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12355-PA 254 GE12355-PA 1..254 1..252 1199 91.7 Plus
Dyak\GE12542-PA 259 GE12542-PA 5..259 7..252 574 45.7 Plus
Dyak\GE13533-PA 256 GE13533-PA 29..256 26..252 542 47.6 Plus
Dyak\GE12354-PA 256 GE12354-PA 29..256 26..252 542 47.6 Plus
Dyak\epsilonTry-PA 256 GE13534-PA 6..256 6..252 517 41.7 Plus