Clone RE72392 Report

Search the DGRC for RE72392

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:723
Well:92
Vector:pFlc-1
Associated Gene/TranscriptGstD11-RA
Protein status:RE72392.pep: gold
Preliminary Size:732
Sequenced Size:1044

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17639 2002-01-01 Sim4 clustering to Release 2
CG17639 2002-02-22 Blastp of sequenced clone
CG17639 2003-01-01 Sim4 clustering to Release 3
CG17639 2008-04-29 Release 5.5 accounting
CG17639 2008-08-15 Release 5.9 accounting
CG17639 2008-12-18 5.12 accounting

Clone Sequence Records

RE72392.complete Sequence

1044 bp (1044 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084188

> RE72392.complete
AAAAGTCAGATAGCGGATACATCGGTGAACAGAGTCGTCGGCAAGTTGGG
ACAGCTGAGACAGATTCCATCACCGCATAGAGTGGCCCACGCACCAGCCA
CCGGAGCAGCAGTAGCAGTAGCAGCATCAGTGTCAGTCATAGTCCTTTGG
CGAGCTCCGGCATACGTGGACGCGGCAACACTCGACGGCATACTGGGTAA
CTGCATCGACATCGACTCGGTGGCCGTGGTGCAGCACAAGCTGGTGCACC
GAATTGTAGGTGGCAAGATGTCGCCGCCCGTGCTGTACTACCTGCCGCCC
AGTCCGCCCTGCCGCAGCATTCTGCTGCTGGCCAAGATGCTGGACATCGA
CTTCGAGCTGAAGATCGTCAACATTTTGGAGGGGGAGCAGCTGAAACCGG
ACTTTGTGGCCATGAATCCGCAGCACTGTGTGCCGACTATGAACGACGAG
GGTCTGGTTTTGTGGGAAAGTCGTGCCATACTCTCCTATCTGGTGGCTGC
CTACGGCAAGAGTGACCAACTGTATCCCACGGACATAAGGGTGAGGGCTT
TGGTGGACCAACGCCTCCAGTTCGATTTGGGCACCCTATACATGCGACTC
ACGGACTACTATTTCCCCACAATGTTTATTGGTGCGCCCCTGGACGAAGG
AAAGCGTGCCAAATTGGCGGAGGCTGTGGGCTGGCTAAACACAATCTTGG
AGGGCAGACAGTTTTCCGCCGCCGATCACTTCACCATCGCGGATCTCACG
CTTTTGGTGACCGTTTCCCAGCTGGAGGCCTTCGAATTTGAACTTCGACC
CTATAAACATATCCGCCAATGGCTCGATCGCTGCAAGGATCACATGGCAC
CGTTTGACTACGAGGAACTCAATGCCAACAAGGCCAATATGTTGGCCGAT
ATGTTCAAGGCCAAGATGAATCAATCGGCGGGCTAACAGTTCTTTAAATT
AGTGTTACAGTAGCGAAAAAATATTTAATATTTAATATCAGTTGTGTAAG
TGTTGTATTAAATAAATAAATTGTTCCGAAAAAAAAAAAAAAAA

RE72392.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG17639-RA 1403 CG17639-RA 374..1403 1..1030 5135 99.9 Plus
CG17639.a 1401 CG17639.a 374..1399 1..1026 5130 100 Plus
CG17639-RB 902 CG17639-RB 130..902 258..1030 3850 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8210593..8211006 613..1026 2070 100 Plus
chr3R 27901430 chr3R 8208743..8208999 1..257 1285 100 Plus
chr3R 27901430 chr3R 8209782..8209994 258..470 1065 100 Plus
chr3R 27901430 chr3R 8210060..8210203 469..612 720 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:15:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12385211..12385630 613..1032 2085 99.8 Plus
3R 32079331 3R 12383361..12383617 1..257 1285 100 Plus
3R 32079331 3R 12384400..12384612 258..470 1065 100 Plus
3R 32079331 3R 12384678..12384821 469..612 720 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12126042..12126461 613..1032 2085 99.7 Plus
3R 31820162 3R 12124192..12124448 1..257 1285 100 Plus
3R 31820162 3R 12125231..12125443 258..470 1065 100 Plus
3R 31820162 3R 12125509..12125652 469..612 720 100 Plus
Blast to na_te.dros performed 2019-03-16 23:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2390 68..142 122 64.1 Plus
Circe 7450 Circe CIRC 7450bp 6549..6603 935..989 122 69.1 Plus

RE72392.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:40:52 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8208743..8208999 1..257 100 -> Plus
chr3R 8209782..8209994 258..470 100 -> Plus
chr3R 8210062..8210203 471..612 100 -> Plus
chr3R 8210593..8211008 613..1028 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:36:02 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
CG17639-RB 54..732 258..936 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:37:36 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
CG17639-RB 54..732 258..936 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:22:25 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
GstD11-RB 54..732 258..936 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:23 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
CG17639-RB 54..732 258..936 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:54:33 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
GstD11-RB 54..732 258..936 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:02:51 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
CG17639-RA 1..1028 1..1028 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:37:36 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
CG17639-RA 1..1028 1..1028 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:22:25 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
GstD11-RA 26..1051 1..1026 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:23 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
CG17639-RA 1..1028 1..1028 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:54:33 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
GstD11-RA 26..1051 1..1026 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:40:52 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12384680..12384821 471..612 100 -> Plus
3R 12384400..12384612 258..470 100 -> Plus
3R 12383361..12383617 1..257 100 -> Plus
3R 12385211..12385626 613..1028 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:40:52 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12384680..12384821 471..612 100 -> Plus
3R 12384400..12384612 258..470 100 -> Plus
3R 12383361..12383617 1..257 100 -> Plus
3R 12385211..12385626 613..1028 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:40:52 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12384680..12384821 471..612 100 -> Plus
3R 12384400..12384612 258..470 100 -> Plus
3R 12383361..12383617 1..257 100 -> Plus
3R 12385211..12385626 613..1028 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:22:25 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8209083..8209339 1..257 100 -> Plus
arm_3R 8210122..8210334 258..470 100 -> Plus
arm_3R 8210402..8210543 471..612 100 -> Plus
arm_3R 8210933..8211348 613..1028 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:42:28 Download gff for RE72392.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12124192..12124448 1..257 100 -> Plus
3R 12125231..12125443 258..470 100 -> Plus
3R 12125511..12125652 471..612 100 -> Plus
3R 12126042..12126457 613..1028 99   Plus

RE72392.hyp Sequence

Translation from 0 to 935

> RE72392.hyp
KSQIADTSVNRVVGKLGQLRQIPSPHRVAHAPATGAAVAVAASVSVIVLW
RAPAYVDAATLDGILGNCIDIDSVAVVQHKLVHRIVGGKMSPPVLYYLPP
SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDE
GLVLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRL
TDYYFPTMFIGAPLDEGKRAKLAEAVGWLNTILEGRQFSAADHFTIADLT
LLVTVSQLEAFEFELRPYKHIRQWLDRCKDHMAPFDYEELNANKANMLAD
MFKAKMNQSAG*

RE72392.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
GstD11-PB 243 CG17639-PB 19..243 87..311 1180 100 Plus
GstD11-PA 222 CG17639-PA 1..222 90..311 1163 100 Plus
GstD1-PB 209 CG10045-PB 5..188 96..279 479 46.2 Plus
GstD1-PA 209 CG10045-PA 5..188 96..279 479 46.2 Plus
GstD2-PA 215 CG4181-PA 4..215 96..305 469 42.9 Plus

RE72392.pep Sequence

Translation from 267 to 935

> RE72392.pep
MSPPVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMN
PQHCVPTMNDEGLVLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRL
QFDLGTLYMRLTDYYFPTMFIGAPLDEGKRAKLAEAVGWLNTILEGRQFS
AADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQWLDRCKDHMAPFDYEE
LNANKANMLADMFKAKMNQSAG*

RE72392.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17948-PA 223 GF17948-PA 1..222 1..222 1114 91.4 Plus
Dana\GF17052-PA 209 GF17052-PA 4..188 6..190 490 45.4 Plus
Dana\GF17054-PA 210 GF17054-PA 3..188 6..190 484 46.2 Plus
Dana\GF17943-PA 218 GF17943-PA 3..188 6..190 468 45.2 Plus
Dana\GF17946-PA 220 GF17946-PA 6..186 6..185 440 45.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18817-PA 222 GG18817-PA 1..222 1..222 1177 98.6 Plus
Dere\GstD1-PA 209 GG17135-PA 4..188 6..190 496 46.5 Plus
Dere\GG17139-PA 210 GG17139-PA 3..188 6..190 484 44.6 Plus
Dere\GG18772-PA 215 GG18772-PA 3..187 6..190 474 44.9 Plus
Dere\GG18761-PA 215 GG18761-PA 3..215 6..216 469 42.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20570-PA 223 GH20570-PA 1..222 1..222 1058 85.1 Plus
Dgri\GH20186-PA 209 GH20186-PA 4..195 6..197 500 46.4 Plus
Dgri\GH13103-PA 209 GH13103-PA 4..195 6..197 496 45.8 Plus
Dgri\GH17521-PA 216 GH17521-PA 3..204 6..205 486 44.6 Plus
Dgri\GH20559-PA 216 GH20559-PA 3..204 6..205 484 44.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
GstD11-PA 222 CG17639-PA 1..222 1..222 1163 100 Plus
GstD11-PB 243 CG17639-PB 22..243 1..222 1163 100 Plus
GstD1-PB 209 CG10045-PB 5..188 7..190 479 46.2 Plus
GstD1-PA 209 CG10045-PA 5..188 7..190 479 46.2 Plus
GstD2-PA 215 CG4181-PA 4..215 7..216 469 42.9 Plus
GstD8-PA 212 CG4421-PA 4..188 7..191 464 44.3 Plus
GstD10-PB 210 CG18548-PB 3..188 6..190 463 44.1 Plus
GstD10-PA 210 CG18548-PA 3..188 6..190 463 44.1 Plus
GstD5-PA 216 CG12242-PA 4..187 7..190 455 44.6 Plus
GstD7-PA 224 CG4371-PA 6..187 6..186 446 47.8 Plus
GstD9-PB 218 CG10091-PB 5..190 7..190 425 44.1 Plus
GstD9-PA 218 CG10091-PA 5..190 7..190 425 44.1 Plus
GstD3-PA 199 CG4381-PA 1..171 20..190 411 42.7 Plus
GstD4-PA 215 CG11512-PA 4..187 7..190 399 41.3 Plus
GstD6-PA 215 CG4423-PA 3..182 6..185 397 41.7 Plus
GstE4-PA 222 CG17525-PA 6..216 6..216 353 37.3 Plus
GstE3-PA 220 CG17524-PA 1..215 1..216 349 36.2 Plus
GstE12-PC 223 CG16936-PC 1..222 1..222 345 36.4 Plus
GstE12-PB 223 CG16936-PB 1..222 1..222 345 36.4 Plus
GstE12-PD 223 CG16936-PD 1..222 1..222 345 36.4 Plus
GstE12-PA 223 CG16936-PA 1..222 1..222 345 36.4 Plus
GstE7-PA 223 CG17531-PA 5..206 5..206 337 36.6 Plus
GstE9-PA 221 CG17534-PA 1..219 1..219 336 36 Plus
GstE5-PA 222 CG17527-PA 6..215 6..215 334 36.6 Plus
GstE6-PA 222 CG17530-PA 6..214 6..214 331 35.8 Plus
GstE8-PB 222 CG17533-PB 1..214 1..214 327 36.5 Plus
GstE8-PA 222 CG17533-PA 1..214 1..214 327 36.5 Plus
GstE1-PA 224 CG5164-PA 7..217 5..216 324 36 Plus
GstE10-PB 240 CG17522-PB 1..218 1..217 322 35.3 Plus
GstE10-PA 240 CG17522-PA 1..218 1..217 322 35.3 Plus
GstE11-PB 225 CG5224-PB 5..216 4..214 321 35.3 Plus
GstE11-PA 225 CG5224-PA 5..216 4..214 321 35.3 Plus
GstE2-PA 221 CG17523-PA 6..218 5..218 307 34.7 Plus
GstE14-PA 232 CG4688-PA 6..188 4..185 299 39.1 Plus
GstE13-PB 226 CG11784-PB 1..210 1..209 293 34.4 Plus
GstE13-PA 226 CG11784-PA 1..210 1..209 293 34.4 Plus
gfzf-PD 234 CG33546-PD 3..189 6..190 261 31 Plus
gfzf-PE 1045 CG33546-PE 814..1000 6..190 261 31 Plus
gfzf-PB 1045 CG33546-PB 814..1000 6..190 261 31 Plus
GstT3-PC 228 CG1702-PC 1..208 1..196 177 29.9 Plus
GstT3-PA 228 CG1702-PA 1..208 1..196 177 29.9 Plus
GstT3-PB 268 CG1702-PB 41..248 1..196 177 29.9 Plus
GstT1-PA 228 CG30000-PA 1..227 1..216 146 24.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23196-PA 223 GI23196-PA 1..222 1..222 1079 88.3 Plus
Dmoj\GI22354-PA 208 GI22354-PA 3..194 6..197 504 46.4 Plus
Dmoj\GI23193-PA 214 GI23193-PA 3..201 6..205 499 46 Plus
Dmoj\GI24379-PA 209 GI24379-PA 4..195 6..197 489 44.8 Plus
Dmoj\GI23195-PA 216 GI23195-PA 3..182 6..185 483 48.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27304-PA 222 GL27304-PA 1..222 1..222 1099 89.6 Plus
Dper\GL27184-PA 209 GL27184-PA 4..188 6..190 499 45.9 Plus
Dper\GL27186-PA 209 GL27186-PA 3..188 6..191 455 42.8 Plus
Dper\GL27303-PA 213 GL27303-PA 3..189 6..191 453 43.9 Plus
Dper\GL27300-PA 217 GL27300-PA 3..182 6..185 453 43.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14590-PA 222 GA14590-PA 1..222 1..222 1099 89.6 Plus
Dpse\GA10031-PA 209 GA10031-PA 4..188 6..190 499 45.9 Plus
Dpse\GA18171-PA 213 GA18171-PA 3..189 6..191 454 43.9 Plus
Dpse\GA14986-PA 209 GA14986-PA 3..188 6..191 451 42.2 Plus
Dpse\GA18009-PA 219 GA18009-PA 3..182 6..185 449 43.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24022-PA 222 GM24022-PA 1..221 1..221 1173 99.5 Plus
Dsec\GstD1-PA 209 GM26019-PA 4..188 6..190 492 45.4 Plus
Dsec\GM26022-PA 210 GM26022-PA 3..188 6..190 485 44.1 Plus
Dsec\GM24017-PA 215 GM24017-PA 3..187 6..190 477 44.9 Plus
Dsec\GM24020-PA 218 GM24020-PA 6..190 6..189 477 47.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18822-PA 252 GD18822-PA 31..252 1..222 1188 100 Plus
Dsim\GstD1-PA 209 GD20577-PA 4..188 6..190 492 45.4 Plus
Dsim\GD20579-PA 210 GD20579-PA 3..188 6..190 486 44.1 Plus
Dsim\GD18815-PA 215 GD18815-PA 3..215 6..216 476 42.3 Plus
Dsim\GD18816-PA 215 GD18816-PA 3..187 6..190 475 44.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22857-PA 223 GJ22857-PA 1..222 1..222 1065 86.5 Plus
Dvir\GJ24385-PA 209 GJ24385-PA 4..188 6..190 489 45.4 Plus
Dvir\GJ14446-PA 213 GJ14446-PA 3..213 6..216 487 44.1 Plus
Dvir\GJ22852-PA 214 GJ22852-PA 3..201 6..205 465 44 Plus
Dvir\GJ22854-PA 213 GJ22854-PA 3..187 6..190 459 44.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11879-PA 223 GK11879-PA 1..222 1..222 1093 88.7 Plus
Dwil\GK11202-PA 218 GK11202-PA 1..217 1..216 500 45 Plus
Dwil\GK11204-PA 209 GK11204-PA 4..188 6..190 491 45.4 Plus
Dwil\GK11878-PA 212 GK11878-PA 3..188 6..192 488 44.4 Plus
Dwil\GK11875-PA 214 GK11875-PA 3..182 6..185 481 48.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26182-PA 222 GE26182-PA 1..222 1..222 1177 98.6 Plus
Dyak\GE24529-PA 210 GE24529-PA 3..195 6..197 495 44 Plus
Dyak\GstD1-PA 209 GE24527-PA 4..188 6..190 488 45.4 Plus
Dyak\GE26175-PA 215 GE26175-PA 3..205 6..206 484 43.8 Plus
Dyak\GE26176-PA 215 GE26176-PA 3..187 6..190 476 44.9 Plus