Clone RE73195 Report

Search the DGRC for RE73195

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:731
Well:95
Vector:pFlc-1
Associated Gene/Transcriptrl-RA
Protein status:RE73195.pep: gold
Sequenced Size:1159

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
rl-RA 2010-01-15 Manual selection by Sue Celniker

Clone Sequence Records

RE73195.complete Sequence

1159 bp assembled on 2010-02-11

GenBank Submission: BT120325.1

> RE73195.complete
ATTTGTCTAAAGAGTAAAAAAAAAAAGAAACGTTAGTCATGGAGGAATTT
AATTCGAGCGGATCAGTAGTTAATGGTACAGGATCTACGGAAGTTCCTCA
ATCTAATGCTGAAGTTATAAGGGGACAAATATTTGAAGTTGGTCCTAGGT
ATATTAAACTCGCCTATATAGGTGAAGGAGCTTATGGCATGGTTGTGTCT
GCGGATGACACGCTAACAAACCAAAGAGTTGCAATAAAAAAAATATCGCC
CTTTGAACACCAAACTTATTGTCAAAGGACTCTCAGAGAAATAACCATAT
TGACCAGATTTAAACATGAAAACATTATTGATATTCGAGATATTCTTCGA
GTTGATAGCATAGACCAAATGAGAGATGTTTATATTGTACAGTGTTTGAT
GGAGACTGATTTGTATAAACTACTTAAAACACAGGTAATGGTGCTCCCTG
ATATTTGGTTAAAATTTATTGAAAGAATAACTACCATTGATATGTGGTGT
ATTATCTTGGCCATTACTCCAAATACCAAGACTGAGTACAATTGTAGGTT
GTCGGACATTTTCAATTATGGAAGTGATTCGCGTTATGCTTTCATGCGGG
CTTTAAAATGATCTGATCAATGTTTAAAGAAGAATGTGGATATTCTCTTT
TTAACTATTTTTACCAGAAATAACTATACTTTAACCTATAATATCTTTAT
AAAAAAATAATAACCATAATCAATGGTAAAAGAATGTTAGTCACACATAA
TTTAAACAGCTTAAGAAGAAATTTAGCATAAGAAACTGTAAGAGATCTAA
GTGTGTGAAGGTATGCATATTAACATGAATTGAGAACGTTTATTTTTCTT
CACAAAACAGCAACACTGTCGAGCCACGCAGCCGGCATCATTAAACAAGA
CCAATTGTAAAAGTTATGGTTAACGTAAATCAGTCATTGTTTTCCTCTTG
CTCATTTATCTAAGCAAACGTTTGCATACATACATTCTTATCTTTACGCT
GAACTTTATACGCAGCCAAAGACAGACAAATTCTCTCAGTTTTGAGGTGA
GTTGTCTACATACGCCGCCTGAATATATACTTTTCTCTCTGGCTTGACCC
TTTCGTTATCAAATAAACTAAAATAAACCAAGAATATTATCCGAAAAAAA
AAAAAAAAA

RE73195.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
rl-RA 1204 rl-RA 332..1204 25..897 4365 100 Plus
rl-RE 1664 rl-RE 87..519 1..434 2130 99.7 Plus
rl.f 1661 rl.f 87..516 1..434 2085 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2RHet 3288813 chr2RHet 207078..207895 324..1141 4090 100 Plus
chr2RHet 3288813 chr2RHet 199014..199187 25..198 870 100 Plus
chr2RHet 3288813 chr2RHet 203381..203507 197..323 635 100 Plus
chr2R 21145070 chr2R 499953..500037 950..866 290 89.4 Minus
chrU 10048995 chrU 1089291..1089375 959..875 230 84.7 Minus
chr2L 23010047 chr2L 22536417..22536487 889..959 220 87.3 Plus
chr2R 21145070 chr2R 446663..446714 1089..1140 200 92.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 1080331..1081156 324..1149 4100 99.8 Plus
2R 25286936 2R 1072268..1072441 25..198 870 100 Plus
2R 25286936 2R 1076635..1076761 197..323 635 100 Plus
2R 25286936 2R 4612345..4612429 950..866 290 89.4 Minus
2R 25286936 2R 1512964..1513048 959..875 230 84.7 Minus
2L 23513712 2L 22645196..22645266 889..959 220 87.3 Plus
2R 25286936 2R 4559056..4559107 1089..1140 200 92.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 1080331..1081156 324..1149 4100 99.7 Plus
2R 25260384 2R 1072268..1072441 25..198 870 100 Plus
2R 25260384 2R 1076635..1076761 197..323 635 100 Plus
2R 25260384 2R 4613544..4613628 950..866 290 89.4 Minus
2R 25260384 2R 1512964..1513048 959..875 230 84.7 Minus
2L 23513712 2L 22645196..22645266 889..959 220 87.3 Plus
2R 25260384 2R 4560255..4560306 1089..1140 200 92.3 Plus
Blast to na_te.dros performed on 2019-03-16 21:52:53 has no hits.

RE73195.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:54:00 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
chr2RHet 198769..198791 1..24 95 -> Plus
chr2RHet 199014..199185 25..196 100 -> Plus
chr2RHet 203381..203507 197..323 100 -> Plus
chr2RHet 207078..207897 324..1143 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 17:16:07 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 1..573 39..611 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:26:09 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 1..573 39..611 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:04:43 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 1..573 39..611 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:35:10 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 1..573 39..611 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 17:16:05 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 66..88 1..24 95 -> Plus
rl-RA 311..975 25..689 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:26:09 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 66..88 1..24 95 -> Plus
rl-RA 311..975 25..689 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:04:43 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 49..71 1..24 95 -> Plus
rl-RA 294..1412 25..1143 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:35:10 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
rl-RA 49..71 1..24 95 -> Plus
rl-RA 294..1412 25..1143 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:00 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1072268..1072439 25..196 100 -> Plus
2R 1076635..1076761 197..323 100 -> Plus
2R 1080331..1081150 324..1143 99   Plus
2R 1072023..1072045 1..24 95 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:00 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1072268..1072439 25..196 100 -> Plus
2R 1076635..1076761 197..323 100 -> Plus
2R 1080331..1081150 324..1143 99   Plus
2R 1072023..1072045 1..24 95 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:00 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1072268..1072439 25..196 100 -> Plus
2R 1076635..1076761 197..323 100 -> Plus
2R 1080331..1081150 324..1143 99   Plus
2R 1072023..1072045 1..24 95 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:04:43 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
2RHet 198737..198759 1..24 95 -> Plus
2RHet 198982..199153 25..196 100 -> Plus
2RHet 203349..203475 197..323 100 -> Plus
2RHet 207045..207864 324..1143 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:50 Download gff for RE73195.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1080331..1081150 324..1143 99   Plus
2R 1072023..1072045 1..24 95 -> Plus
2R 1072268..1072439 25..196 100 -> Plus
2R 1076635..1076761 197..323 100 -> Plus

RE73195.pep Sequence

Translation from 38 to 610

> RE73195.pep
MEEFNSSGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYG
MVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIR
DILRVDSIDQMRDVYIVQCLMETDLYKLLKTQVMVLPDIWLKFIERITTI
DMWCIILAITPNTKTEYNCRLSDIFNYGSDSRYAFMRALK*

RE73195.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13942-PA 229 GF13942-PA 1..82 51..132 417 98.8 Plus
Dana\GF23057-PA 365 GF23057-PA 18..123 32..132 193 38.7 Plus
Dana\GF14126-PA 371 GF14126-PA 17..117 32..130 178 38.6 Plus
Dana\GF18893-PA 366 GF18893-PA 19..126 32..134 177 37 Plus
Dana\GF20951-PA 352 GF20951-PA 11..111 37..137 164 42.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23119-PA 539 GG23119-PA 1..132 1..132 680 96.2 Plus
Dere\GG23876-PA 361 GG23876-PA 14..119 32..132 192 38.7 Plus
Dere\GG23964-PA 372 GG23964-PA 18..118 32..130 178 38.6 Plus
Dere\GG12369-PA 366 GG12369-PA 19..124 32..132 165 36.8 Plus
Dere\GG18504-PA 353 GG18504-PA 11..109 37..136 161 41.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13352-PA 378 GH13352-PA 22..134 20..132 570 95.6 Plus
Dgri\GH11110-PA 361 GH11110-PA 14..119 32..132 187 37.7 Plus
Dgri\GH13559-PA 369 GH13559-PA 15..115 32..130 180 39.6 Plus
Dgri\GH19092-PA 366 GH19092-PA 19..124 32..132 171 38.7 Plus
Dgri\GH14986-PA 546 GH14986-PA 162..248 44..129 159 35.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
rl-PA 190 CG12559-PA 1..190 1..190 980 100 Plus
rl-PI 376 CG12559-PI 1..132 1..132 670 100 Plus
rl-PC 376 CG12559-PC 1..132 1..132 670 100 Plus
rl-PD 376 CG12559-PD 1..132 1..132 670 100 Plus
rl-PE 376 CG12559-PE 1..132 1..132 670 100 Plus
rl-PG 331 CG12559-PG 6..87 51..132 403 96.3 Plus
p38b-PA 365 CG7393-PA 18..123 32..132 189 38.7 Plus
bsk-PE 372 CG5680-PE 18..118 32..130 179 38.6 Plus
bsk-PF 372 CG5680-PF 18..118 32..130 179 38.6 Plus
bsk-PB 372 CG5680-PB 18..118 32..130 179 38.6 Plus
p38a-PC 366 CG5475-PC 19..124 32..132 165 36.8 Plus
p38a-PB 366 CG5475-PB 19..124 32..132 165 36.8 Plus
p38a-PA 366 CG5475-PA 19..124 32..132 165 36.8 Plus
Cdk7-PA 353 CG3319-PA 11..115 37..142 164 40.9 Plus
nmo-PC 414 CG7892-PC 46..132 44..129 158 35.6 Plus
nmo-PB 414 CG7892-PB 46..132 44..129 158 35.6 Plus
nmo-PA 414 CG7892-PA 46..132 44..129 158 35.6 Plus
nmo-PH 430 CG7892-PH 46..132 44..129 158 35.6 Plus
nmo-PG 430 CG7892-PG 46..132 44..129 158 35.6 Plus
nmo-PF 430 CG7892-PF 46..132 44..129 158 35.6 Plus
nmo-PE 430 CG7892-PE 46..132 44..129 158 35.6 Plus
Erk7-PC 451 CG32703-PC 24..129 31..144 148 37.1 Plus
Erk7-PB 916 CG32703-PB 24..129 31..144 148 37.1 Plus
Erk7-PA 916 CG32703-PA 24..129 31..144 148 37.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18259-PA 339 GI18259-PA 19..131 20..132 569 95.6 Plus
Dmoj\GI18232-PA 361 GI18232-PA 14..119 32..132 193 38.7 Plus
Dmoj\GI10639-PA 366 GI10639-PA 15..115 32..130 179 39.6 Plus
Dmoj\GI23428-PA 366 GI23428-PA 19..124 32..132 174 38.7 Plus
Dmoj\GI15304-PA 349 GI15304-PA 11..109 37..136 163 42.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20446-PA 375 GL20446-PA 1..132 1..132 599 85.6 Plus
Dper\GL21224-PA 343 GL21224-PA 14..119 32..132 193 38.7 Plus
Dper\GL18977-PA 371 GL18977-PA 17..117 32..130 175 38.6 Plus
Dper\GL24141-PA 366 GL24141-PA 19..124 32..132 165 35.8 Plus
Dper\GL14332-PA 350 GL14332-PA 9..109 35..136 163 41.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20320-PA 365 GA20320-PA 18..123 32..132 193 38.7 Plus
Dpse\GA18909-PA 366 GA18909-PA 19..124 32..132 165 35.8 Plus
Dpse\GA17354-PA 350 GA17354-PA 9..109 35..136 163 41.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16932-PA 340 GM16932-PA 1..132 1..132 679 97.7 Plus
Dsec\GM15179-PA 365 GM15179-PA 18..123 32..132 191 38.7 Plus
Dsec\GM11912-PA 372 GM11912-PA 18..118 32..130 178 38.6 Plus
Dsec\GM23508-PA 366 GM23508-PA 19..124 32..132 168 36.8 Plus
Dsec\GM12652-PA 353 GM12652-PA 11..109 37..136 161 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23919-PA 365 GD23919-PA 18..123 32..132 191 38.7 Plus
Dsim\GD22289-PA 372 GD22289-PA 18..118 32..130 178 38.6 Plus
Dsim\GD18318-PA 366 GD18318-PA 19..124 32..132 168 36.8 Plus
Dsim\GD24595-PA 353 GD24595-PA 11..109 37..136 161 41.3 Plus
Dsim\GD14046-PA 430 GD14046-PA 46..132 44..129 159 35.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17518-PA 375 GJ17518-PA 1..131 1..132 570 85.6 Plus
Dvir\GJ18140-PA 361 GJ18140-PA 14..119 32..132 186 37.7 Plus
Dvir\GJ21884-PA 369 GJ21884-PA 15..115 32..130 180 39.6 Plus
Dvir\GJ16576-PA 352 GJ16576-PA 11..109 37..136 163 42.3 Plus
Dvir\GJ13897-PA 519 GJ13897-PA 135..221 44..129 159 35.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18192-PA 364 GK18192-PA 14..119 32..132 193 38.7 Plus
Dwil\GK23361-PA 184 GK23361-PA 50..88 95..133 190 94.9 Plus
Dwil\GK18964-PA 352 GK18964-PA 11..112 29..132 185 38.1 Plus
Dwil\GK12444-PA 371 GK12444-PA 17..117 32..130 174 38.6 Plus
Dwil\GK20588-PA 520 GK20588-PA 136..222 44..129 159 35.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11327-PA 376 GE11327-PA 1..132 1..132 681 97.7 Plus
Dyak\GE18678-PA 365 GE18678-PA 18..123 32..132 191 38.7 Plus
Dyak\GE26274-PA 372 GE26274-PA 18..118 32..130 178 38.6 Plus
Dyak\GE16821-PA 353 GE16821-PA 11..109 37..136 161 41.3 Plus
Dyak\GE10824-PA 366 GE10824-PA 19..124 32..132 161 35.8 Plus

RE73195.hyp Sequence

Translation from 38 to 610

> RE73195.hyp
MEEFNSSGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYG
MVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIR
DILRVDSIDQMRDVYIVQCLMETDLYKLLKTQVMVLPDIWLKFIERITTI
DMWCIILAITPNTKTEYNCRLSDIFNYGSDSRYAFMRALK*

RE73195.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
rl-PA 190 CG12559-PA 1..190 1..190 980 100 Plus
rl-PI 376 CG12559-PI 1..132 1..132 670 100 Plus
rl-PC 376 CG12559-PC 1..132 1..132 670 100 Plus
rl-PD 376 CG12559-PD 1..132 1..132 670 100 Plus
rl-PE 376 CG12559-PE 1..132 1..132 670 100 Plus